Human MST3 kinase in complex with MnADP. Determined by X-ray diffraction at 1.5 Å resolution. Released 2 Feb 2010.
Explore 3A7J in 3D Show helices and sheets RCSB PDB PDBe
3A7J contains 19 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17-18 | 2 | 1 |
| α-helix | 20-22 | 3 | |
| β-strand | 24-32 | 9 | 1 |
| β-strand | 37-43 | 7 | 1 |
| β-strand | 49-56 | 8 | 1 |
| α-helix | 64-76 | 13 | |
| β-strand | 82 | 1 | 2 |
| α-helix | 83-84 | 2 | |
| β-strand | 85-91 | 7 | 1 |
| β-strand | 94-100 | 7 | 1 |
| β-strand | 105-106 | 2 | 2 |
| α-helix | 107-111 | 5 | |
| α-helix | 115-117 | 3 | |
| α-helix | 118-137 | 20 | |
| β-strand | 140-141 | 2 | 3 |
| α-helix | 147-149 | 3 | |
| β-strand | 150-152 | 3 | 2 |
| β-strand | 158-160 | 3 | 2 |
| β-strand | 167-168 | 2 | 3 |
| β-strand | 176 | 1 | 4 |
| α-helix | 183-185 | 3 | |
| α-helix | 188-191 | 4 | |
| β-strand | 196 | 1 | 4 |
| α-helix | 199-214 | 16 | |
| α-helix | 224-233 | 10 | |
| α-helix | 235-237 | 3 | |
| α-helix | 245-254 | 10 | |
| α-helix | 259-261 | 3 | |
| α-helix | 263-264 | 2 | |
| α-helix | 265-268 | 4 | |
| α-helix | 272-277 | 6 | |
| α-helix | 281-283 | 3 | |
| α-helix | 284-297 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serine/threonine kinase 24 (STE20 homolog, yeast) | A | protein | 303 | Homo sapiens | Q9Y6E0 (AlphaFold model) |
>3A7J_1 Serine/threonine kinase 24 (STE20 homolog, yeast) (chains A) MAHSPVQSGLPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEA EDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQ IATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFV GTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLE GNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQSH DDS
Structures of human MST3 kinase in complex with adenine, ADP and Mn2+. Ko, T.P., Jeng, W.Y., Liu, C.I. et al. Acta Crystallogr D Biol Crystallogr (2010) 66:145-154. DOI 10.1107/S0907444909047507 · PubMed
Other PDB entries of the same protein (UniProt Q9Y6E0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3A7J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.