4U8Z: MST3 with a pyrrolopyrimidine inhibitor

Crystal structure of MST3 with a pyrrolopyrimidine inhibitor (PF-06447475). Determined by X-ray diffraction at 1.63 Å resolution. Released 18 Mar 2015.

Method: X-ray diffraction
Resolution: 1.63 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,605
Mol. weight: 33.32 kDa
Ligands: 3FE, MN
Released: 18 Mar 2015

Explore 4U8Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4U8Z contains 18 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	13	1	1
α-helix	20-23	4
β-strand	24-33	10	1
β-strand	36-43	8	1
β-strand	49-56	8	1
α-helix	64-76	13
β-strand	82	1	2
β-strand	85-91	7	1
β-strand	94-100	7	1
β-strand	105-106	2	2
α-helix	107-110	4
α-helix	115-117	3
α-helix	118-137	20
β-strand	140-141	2	3
α-helix	147-149	3
β-strand	150-152	3	2
β-strand	158-160	3	2
β-strand	167-168	2	3
β-strand	176	1	4
α-helix	183-185	3
α-helix	188-191	4
β-strand	196	1	4
α-helix	199-214	16
α-helix	224-233	10
α-helix	235-237	3
α-helix	245-254	10
α-helix	259-261	3
α-helix	263-264	2
α-helix	265-268	4
α-helix	272-277	6
α-helix	281-284	4
α-helix	285-296	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase 24	A	protein	290	Homo sapiens	Q9Y6E0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4U8Z_1 Serine/threonine-protein kinase 24 (chains A)
GLPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQ
QEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREI
LKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAP
EVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLK
EFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ

Ligands and cofactors

ID	Name	Formula	Copies
3FE	3-[4-(morpholin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-5-yl]benzonitrile	C17 H15 N5 O	1
MN	Manganese (II) ion	Mn	1

Primary citation

Discovery and preclinical profiling of 3-[4-(morpholin-4-yl)-7H-pyrrolo[2,3-d]pyrimidin-5-yl]benzonitrile (PF-06447475), a highly potent, selective, brain penetrant, and in vivo active LRRK2 kinase inhibitor. Henderson, J.L., Kormos, B.L., Hayward, M.M. et al. J Med Chem (2015) 58:419-432. DOI 10.1021/jm5014055 · PubMed

Other PDB entries of the same protein (UniProt Q9Y6E0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3A7I 1.45 Å, Human MST3 kinase in complex with adenine
8QLT 1.47 Å, Human MST3 (STK24) kinase in complex with inhibitor MR30
3A7J 1.5 Å, Human MST3 kinase in complex with MnADP
4QMT 1.5 Å, MST3 in complex with HESPERADIN
4QMU 1.55 Å, MST3 in complex with jnj-7706621, 4-({5-amino-1-[(2,6-difluorophenyl)carbonyl]-1H-1,2,4-t…
3A7F 1.55 Å, Human MST3 kinase
4QMW 1.6 Å, MST3 in complex with pp-121, 1-cyclopentyl-3-(1H-PYRROLO[2,3-b]pyridin-5-yl)-1H-PYRAZOLO[…
8QLS 1.61 Å, Human MST3 (STK24) kinase in complex with inhibitor MR26
8QLQ 1.64 Å, Human MST3 (STK24) kinase in complex with macrocyclic inhibitor JA310
8BZI 1.72 Å, Human MST3 (STK24) kinase in complex with inhibitor MR39
7B32 1.75 Å, MST3 in complex with MRIA7
4QMQ 1.77 Å, MST3 in complex with CP-673451

Browse structure collections

About this viewer

MolViewer shows 4U8Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.