3A7S: Catalytic domain of UCH37

Catalytic domain of UCH37. Determined by X-ray diffraction at 2.2 Å resolution. Released 3 Nov 2009.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,626
Mol. weight: 25.7 kDa
Released: 3 Nov 2009

Explore 3A7S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3A7S contains 11 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	15-24	10
β-strand	28	1	1
β-strand	31-35	5	2
α-helix	40-44	5
α-helix	47	1
β-strand	49-56	8	2
α-helix	62-64	3
β-strand	67-68	2	2
α-helix	85-87	3
α-helix	88-97	10
β-strand	106	1	1
α-helix	109-118	10
α-helix	123-131	9
α-helix	134-143	10
β-strand	164-171	8	2
β-strand	174-179	6	2
β-strand	186-190	5	2
α-helix	193-195	3
α-helix	197-213	17
β-strand	218-224	7	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin carboxyl-terminal hydrolase isozyme L5	A	protein	228	Homo sapiens	Q9Y5K5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3A7S_1 Ubiquitin carboxyl-terminal hydrolase isozyme L5 (chains A)
MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQP
GEEPAGSVVQDSRLDTIFFAKQVINNAAATQAIVSVLLNCTHQDVHLGETLSEFKEFSQS
FDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDG
LREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK

Primary citation

Crystal structure of the de-ubiquitinating enzyme UCH37 (human UCH-L5) catalytic domain. Nishio, K., Kim, S.W., Kawai, K. et al. Biochem Biophys Res Commun (2009). DOI 10.1016/j.bbrc.2009.10.062 · PubMed

Other PDB entries of the same protein (UniProt Q9Y5K5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3RII 2.0 Å, Crystal structure of the catalytic domain of UCHL5, a proteasome-associated human…
3TB3 2.3 Å, Crystal structure of the UCH domain of UCH-L5 with 6 residues deleted
4UEL 2.3 Å, UCH-L5 in complex with ubiquitin-propargyl bound to the RPN13 DEUBAD domain
3RIS 2.4 Å, Crystal structure of the catalytic domain of UCHL5, a proteasome-associated human…
9E7K 2.41 Å, Crystal structure of the UCH37 RPN13 DEUBAD complex bound to an inhibitory nanobody in…
4UEM 2.82 Å, UCH-L5 in complex with the RPN13 DEUBAD domain
3IHR 2.95 Å, Crystal Structure of Uch37
4WLP 3.1 Å, Crystal structure of UCH37-NFRKB Inhibited Deubiquitylating Complex
4UF6 3.69 Å, UCH-L5 in complex with ubiquitin-propargyl bound to an activating fragment of INO80G
4UF5 3.7 Å, Crystal structure of UCH-L5 in complex with inhibitory fragment of INO80G

Browse structure collections

About this viewer

MolViewer shows 3A7S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.