3AAD: Transcription initiation factor TFIID subunit 1

Structure of the histone chaperone CIA/ASF1-double bromodomain complex linking histone modifications and site-specific histone eviction. Determined by X-ray diffraction at 3.3 Å resolution. Released 28 Apr 2010.

Method: X-ray diffraction
Resolution: 3.3 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,617
Mol. weight: 70.22 kDa
Released: 28 Apr 2010

Explore 3AAD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3AAD contains 25 α-helices and 24 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 0 β-strands

Element	Residues	Length
α-helix	1381-1396	16
α-helix	1403-1405	3
α-helix	1417-1420	4
α-helix	1427-1435	9
α-helix	1442-1459	18
α-helix	1465-1470	6
α-helix	1472-1475	4
α-helix	1481-1483	3
α-helix	1485-1493	9
α-helix	1502-1513	12
α-helix	1514-1518	5
α-helix	1519-1521	3
α-helix	1526-1528	3
α-helix	1531-1533	3
α-helix	1540-1543	4
α-helix	1550-1558	9
α-helix	1565-1583	19
α-helix	1588-1627	40

Chain B: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-8	5	1
β-strand	11	1	1
β-strand	16-17	2	2
α-helix	21	1
β-strand	22-30	9	1
β-strand	40-45	6	2
β-strand	55-60	6	2
β-strand	68-76	9	1
α-helix	77-79	3
α-helix	81-83	3
β-strand	92-101	10	2
β-strand	104-117	14	2
α-helix	132-134	3
β-strand	135-139	5	2
β-strand	145-148	4	2

Chain D: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	3
β-strand	11	1	4
β-strand	16-17	2	5
α-helix	21	1
β-strand	22-24	3	4
β-strand	27-30	4	3
β-strand	39-44	6	5
β-strand	55-60	6	5
β-strand	68-71	4	3
β-strand	74-76	3	4
α-helix	77-79	3
α-helix	81-83	3
β-strand	91-101	11	5
β-strand	104-117	14	5
β-strand	135-139	5	5
β-strand	145-147	3	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription initiation factor TFIID subunit 1	A	protein	292	Homo sapiens	P21675 (AlphaFold model)
Histone chaperone ASF1A	B, D	protein	158	Homo sapiens	Q9Y294 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3AAD_1 Transcription initiation factor TFIID subunit 1 (chains A)
GSHMVLKFPKQQLPPKKKRRVGTTVHCDYLNRPHKSIHRRRTDPMVTLSSILESIINDMR
DLPNTYPFHTPVNAKVVKDYYKIITRPMDLQTLRENVRKRLYPSREEFREHLELIVKNSA
TYNGPKHSLTQISQSMLDLCDEKLKEKEDKLARLEKAINPLLDDDDQVAFSFILDNIVTQ
KMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILA
NSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEEA

Sequence of entity 2 (B, D), FASTA

>3AAD_2 Histone chaperone ASF1A (chains B, D)
GSHMAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVL
DSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEY
TETELRENPPVKPDFSKLQRNILASNPRVTRFHINWED

Primary citation

Structure of the histone chaperone CIA/ASF1-double bromodomain complex linking histone modifications and site-specific histone eviction. Akai, Y., Adachi, N., Hayashi, Y. et al. Proc Natl Acad Sci U S A (2010) 107:8153-8158. DOI 10.1073/pnas.0912509107 · PubMed

Other PDB entries of the same protein (UniProt P21675 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5I29 1.21 Å, TAF1(2) bound to a pyrrolopyridone compound
7LB1 1.35 Å, Crystal structure of the tandem bromodomain (BD1, BD2) of human TAF1 bound to ZS1-585
4YYM 1.5 Å, Crystal structure of TAF1 BD2 Bromodomain bound to a butyryllysine peptide
5I1Q 1.5 Å, Second bromodomain of TAF1 bound to a pyrrolopyridone compound
7K27 1.5 Å, Crystal structure of the tandem bromodomain (BD1, BD2) of human TAF1 bound to ATR…
7JJG 1.6 Å, Crystal structure of the second bromodomain (BD2) of human TAF1 bound to ATR kinase…
7K03 1.6 Å, Crystal structure of the tandem bromodomain (BD1 and BD2) of human TAF1 bound to ATR…
7T36 1.65 Å, Crystal structure of the tandem bromodomain (BD1 and BD2) of human TAF1 bound to ZS1-322
7JSP 1.7 Å, Crystal structure of the second bromodomain (BD2) of human TAF1 bound to ATR kinase…
7K3O 1.7 Å, Crystal structure of the unliganded second bromodomain (BD2) of human TAF1
7K42 1.7 Å, Crystal structure of the second bromodomain (BD2) of human TAF1 bound to dioxane
7LB2 1.7 Å, Crystal structure of the tandem bromodomain (BD1, BD2) of human TAF1 bound to ZS1-589

Browse structure collections

About this viewer

MolViewer shows 3AAD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.