3AGZ: Human Hsp40 Hdj1 peptide-binding domain

Crystal structure of human Hsp40 Hdj1 peptide-binding domain complexed with a C-terminal peptide of Hsp70. Determined by X-ray diffraction at 2.51 Å resolution. Released 23 Feb 2011.

Method: X-ray diffraction
Resolution: 2.51 Å
Organism: Homo sapiens
Chains: 6
Atoms: 3,255
Mol. weight: 46.39 kDa
Released: 23 Feb 2011

Explore 3AGZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3AGZ contains 16 α-helices and 34 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	160	1	1
α-helix	161-163	3
β-strand	164-170	7	2
α-helix	172-177	6
β-strand	179-190	12	3
β-strand	197-208	12	3
α-helix	212-213	2
β-strand	217-220	4	2
β-strand	231	1	1
α-helix	232-234	3
β-strand	235-241	7	2
α-helix	242-243	2
β-strand	248-250	3	4
β-strand	253-261	9	4
α-helix	262-267	6
β-strand	269-274	6	5
β-strand	280-285	6	5
β-strand	294-297	4	4
β-strand	303	1	6
β-strand	311	1	6
β-strand	314-321	8	4
α-helix	322-323	2
α-helix	328-335	8

Chain B: 6 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	160	1	7
β-strand	164-170	7	8
α-helix	172-177	6
β-strand	179-190	12	9
β-strand	197-208	12	9
β-strand	217-220	4	8
β-strand	231	1	7
α-helix	232-234	3
β-strand	235-241	7	8
β-strand	248-250	3	10
β-strand	253-261	9	10
α-helix	262-267	6
β-strand	269-274	6	11
β-strand	280-285	6	11
β-strand	294-297	4	10
α-helix	302	1
β-strand	303	1	12
α-helix	304	1
β-strand	311	1	12
β-strand	314-321	8	10
α-helix	328-337	10

Chains C and D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	636-640	5	3

Chain E: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	635	1
β-strand	636-638	3	2
α-helix	639-640	2

Chain F: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	636-638	3	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DnaJ homolog subfamily B member 1	A, B	protein	190	Homo sapiens	P25685 (AlphaFold model)
peptide of Heat shock cognate 71 kDa protein	C, D, E, F	protein	8	Homo sapiens	P11142 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3AGZ_1 DnaJ homolog subfamily B member 1 (chains A, B)
SAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKK
GWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCT
VNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTS
RTVLEQVLPI

Sequence of entity 2 (C, D, E, F), FASTA

>3AGZ_2 peptide of Heat shock cognate 71 kDa protein (chains C, D, E, F)
GPTIEEVD

Primary citation

Peptide-binding sites as revealed by the crystal structures of the human Hsp40 Hdj1 C-terminal domain in complex with the octapeptide from human Hsp70. Suzuki, H., Noguchi, S., Arakawa, H. et al. Biochemistry (2010) 49:8577-8584. DOI 10.1021/bi100876n · PubMed

Other PDB entries of the same protein (UniProt P25685 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3AGX 1.85 Å, Crystal structure of human Hsp40 Hdj1 peptide-binding domain
3AGY 1.85 Å, Crystal structure of human Hsp40 Hdj1 peptide-binding domain complexed with a C-terminal…
4WB7 1.9 Å, Crystal structure of a chimeric fusion of human DnaJ (Hsp40) and cAMP-dependent protein…
8FE2 2.34 Å, Structure of J-PKAc chimera complexed with Aplithianine A
9NFS 2.45 Å, Structure of J-PKAc chimera in complex with Aplithianine j1
8FE5 2.51 Å, Structure of J-PKAc chimera complexed with Aplithianine B
7NDX 2.54 Å, Crystal structure of the human HSP40 DNAJB1-CTDs in complex with a peptide of NudC
2QLD 2.7 Å, human Hsp40 Hdj1
8FEC 2.7 Å, Structure of J-PKAc chimera complexed with Aplithianine derivative
6BYR 3.66 Å, Structures of the PKA RI alpha holoenzyme with the FLHCC driver J-PKAc alpha or native…
6WJG 6.2 Å, PKA RIIbeta holoenzyme with DnaJB1-PKAc fusion in fibrolamellar hepatoceullar carcinoma
6WJF 7.5 Å, PKA RIIbeta holoenzyme with DnaJB1-PKAc fusion in fibrolamellar hepatoceullar carcinoma

Browse structure collections

About this viewer

MolViewer shows 3AGZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.