3AJM: Programmed cell death 10

Crystal structure of programmed cell death 10 in complex with inositol 1,3,4,5-tetrakisphosphate. Determined by X-ray diffraction at 2.3 Å resolution. Released 30 Jun 2010.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,318
Mol. weight: 50.29 kDa
Ligands: 4IP
Released: 30 Jun 2010

Explore 3AJM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3AJM contains 25 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	17-19	3
α-helix	20-21	2
α-helix	22-26	5
α-helix	27-36	10
α-helix	38-54	17
α-helix	58-68	11
α-helix	70-83	14
α-helix	84-86	3
α-helix	98-115	18
α-helix	117-120	4
α-helix	124-151	28
α-helix	157-184	28
α-helix	187-210	24

Chain B: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	17-19	3
α-helix	20-21	2
α-helix	22-26	5
α-helix	27-33	7
α-helix	38-54	17
α-helix	58-68	11
α-helix	70-83	14
α-helix	98-115	18
α-helix	117-119	3
α-helix	124-149	26
α-helix	158-184	27
α-helix	187-207	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Programmed cell death protein 10	A, B	protein	213	Homo sapiens	Q9BUL8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3AJM_1 Programmed cell death protein 10 (chains A, B)
MKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKIL
EKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRF
LQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKA
INVFVSANRLIHQTNLILQTFKTVALEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
4IP	Inositol-(1,3,4,5)-tetrakisphosphate	C6 H16 O18 P4	1

Primary citation

Crystal structure of human programmed cell death 10 complexed with inositol-(1,3,4,5)-tetrakisphosphate: a novel adaptor protein involved in human cerebral cavernous malformation. Ding, J., Wang, X., Li, D.F. et al. Biochem Biophys Res Commun (2010) 399:587-592. DOI 10.1016/j.bbrc.2010.07.119 · PubMed

Other PDB entries of the same protein (UniProt Q9BUL8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4GEH 1.95 Å, Crystal structure of MST4 dimerization domain complex with PDCD10
3W8I 2.4 Å, Crystal structure of CCM3 in complex with the C-terminal regulatory domain of MST4
3W8H 2.43 Å, Crystal structure of CCM3 in complex with the C-terminal regulatory domain of STK25
3L8I 2.5 Å, Crystal structure of CCM3, a cerebral cavernous malformation protein critical for…
3RQG 2.5 Å, Cerebral cavernous malformation 3 (CCM3) in complex with paxillin LD4
3RQF 2.7 Å, Cerebral cavernous malformation 3 (CCM3) in complex with paxillin LD2
3RQE 2.8 Å, Cerebral cavernous malformation 3 (CCM3) in complex with paxillin LD1
4TVQ 2.8 Å, CCM3 in complex with CCM2 LD-like motif
3L8J 3.05 Å, Crystal structure of CCM3, a cerebral cavernous malformation protein critical for…

Browse structure collections

About this viewer

MolViewer shows 3AJM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.