3AJO: Wild-type human ferritin H chain

Crystal structure of wild-type human ferritin H chain. Determined by X-ray diffraction at 1.52 Å resolution. Released 25 Aug 2010.

Method: X-ray diffraction
Resolution: 1.52 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,714
Mol. weight: 21.42 kDa
Ligands: MG
Released: 25 Aug 2010

Explore 3AJO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3AJO contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	14-40	27
α-helix	49-76	28
α-helix	86-88	3
α-helix	96-123	28
α-helix	127-133	7
α-helix	134-138	5
α-helix	139-158	20
α-helix	164-173	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ferritin heavy chain	A	protein	182	Homo sapiens	P02794 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3AJO_1 Ferritin heavy chain (chains A)
TTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSH
EEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKL
ATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDN
ES

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	12

Primary citation

The universal mechanism for iron translocation to the ferroxidase site in ferritin, which is mediated by the well conserved transit site. Masuda, T., Goto, F., Yoshihara, T. et al. Biochem Biophys Res Commun (2010) 400:94-99. DOI 10.1016/j.bbrc.2010.08.017 · PubMed

Other PDB entries of the same protein (UniProt P02794 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6B8F 1.06 Å, Contracted Human Heavy-Chain Ferritin Crystal-Hydrogel Hybrid
6B8G 1.13 Å, Twice-Contracted Human Heavy-Chain Ferritin Crystal-Hydrogel Hybrid
7A6A 1.15 Å, 1.15 A structure of human apoferritin obtained from Titan Mono- BCOR microscope
8B7O 1.17 Å, X-ray structure of Auranofin-human H-chain ferritin
6WYF 1.25 Å, Crystal structure of Human H-chain Ferritin variant 157C Delta C-star Modified with a…
6Z6U 1.25 Å, 1.25 A structure of human apoferritin obtained from Titan Mono-BCOR microscope
7RRP 1.27 Å, Apoferritin structure at 1.27 angstrom resolution determined from a 300 kV Titan Krios…
7A6B 1.33 Å, 1.33 A structure of human apoferritin obtained from Titan Mono- BCOR microscope
4Y08 1.34 Å, One minute iron loaded human H ferritin
7K3V 1.34 Å, Apoferritin structure at 1.34 angstrom resolution determined from a 300 kV Titan Krios…
7K3W 1.36 Å, Apoferritin structure at 1.36 angstrom resolution determined from a 300 kV Titan Krios…
9RGH 1.38 Å, X-ray structure of a polyoxidovanadate/human H-ferritin adduct obtained when the protein…

Browse structure collections

About this viewer

MolViewer shows 3AJO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.