Structural and biochemical characterization of ClfB:ligand interactions. Determined by X-ray diffraction at 2.45 Å resolution. Released 4 May 2011.
Explore 3AU0 in 3D Show helices and sheets RCSB PDB PDBe
3AU0 contains 7 α-helices and 29 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 214 | 1 | 1 |
| α-helix | 216-218 | 3 | |
| β-strand | 219-226 | 8 | 2 |
| β-strand | 230-231 | 2 | 3 |
| α-helix | 233-235 | 3 | |
| β-strand | 239-247 | 9 | 2 |
| β-strand | 253 | 1 | 4 |
| β-strand | 255 | 1 | 4 |
| β-strand | 256-260 | 5 | 1 |
| β-strand | 265-266 | 2 | 5 |
| β-strand | 271 | 1 | 6 |
| β-strand | 279-286 | 8 | 1 |
| β-strand | 292-299 | 8 | 1 |
| β-strand | 304-309 | 6 | 1 |
| α-helix | 311-313 | 3 | |
| β-strand | 320-327 | 8 | 2 |
| β-strand | 328-329 | 2 | 5 |
| β-strand | 338-341 | 4 | 3 |
| β-strand | 344-346 | 3 | 1 |
| β-strand | 350-351 | 2 | 1 |
| β-strand | 354-357 | 4 | 3 |
| α-helix | 359-361 | 3 | |
| β-strand | 374-381 | 8 | 6 |
| β-strand | 389-396 | 8 | 6 |
| β-strand | 403-411 | 9 | 7 |
| α-helix | 417-419 | 3 | |
| β-strand | 422-423 | 2 | 6 |
| β-strand | 430-436 | 7 | 6 |
| α-helix | 439-441 | 3 | |
| β-strand | 455-457 | 3 | 6 |
| α-helix | 460-462 | 3 | |
| β-strand | 466-467 | 2 | 7 |
| β-strand | 473-481 | 9 | 7 |
| β-strand | 485-493 | 9 | 6 |
| β-strand | 500-509 | 10 | 7 |
| β-strand | 518-526 | 9 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Clumping factor B | A | protein | 339 | Staphylococcus aureus | Q7A382 (AlphaFold model) |
>3AU0_1 Clumping factor B (chains A) PVVNVADAKGTNVNDKVTASNFKLEKTTFDPNQSGNTFMAANFTVTDKVKSGDYFTAKLP DSLTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYDILTKTYTFVFTDYVNNKENINGQ FSLPLFTDRAKAPKSGTYDANINIADEMFNNKITYNYSSPIAGIDKPNGANISSQIIGVD TASGQNTYKQTVFVNPKQRVLGNTWVYIKGYQDKIEESSGKVSATDTKLRIFEVNDTSKL SESYYADPNDSNLKEVTDQFKNRIYYEHPNVASIKFGDITKTYVVLVEGHYDNTGKNLKT QVIQENVDPVTNRDYSIFGWNNENVVRYGGGSADGDSAV
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 2 |
Structural and biochemical characterization of ClfB:ligand interactions. Ganesh, V.K., Barbu, E.M., Deivanayagam, C.C.S. et al. To be published.
Other PDB entries of the same protein (UniProt Q7A382 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3AU0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.