3AXC: Linear diubiquitin

Crystal structure of linear diubiquitin. Determined by X-ray diffraction at 2.19 Å resolution. Released 25 Jan 2012.

Method: X-ray diffraction
Resolution: 2.19 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,224
Mol. weight: 17.37 kDa
Released: 25 Jan 2012

Explore 3AXC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3AXC contains 7 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	1
β-strand	12-16	5	1
β-strand	22	1	2
α-helix	23-34	12
α-helix	38-40	3
β-strand	41-45	5	1
β-strand	48-49	2	1
α-helix	50-51	2
β-strand	55	1	2
β-strand	66-71	6	1
β-strand	78-83	6	3
β-strand	88-92	5	3
β-strand	98	1	4
α-helix	99-110	12
α-helix	114-116	3
β-strand	117-121	5	3
β-strand	124-125	2	3
α-helix	126-127	2
β-strand	131	1	4
α-helix	132-135	4
β-strand	142-147	6	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin	A	protein	154	Homo sapiens	P62979 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3AXC_1 Ubiquitin (chains A)
GSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD
YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQR
LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG

Primary citation

Structure of a compact conformation of linear diubiquitin. Rohaim, A., Kawasaki, M., Kato, R. et al. Acta Crystallogr D Biol Crystallogr (2012) 68:102-108. DOI 10.1107/S0907444911051195 · PubMed

Other PDB entries of the same protein (UniProt P62979 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3NHE 1.26 Å, High Resolution Structure (1.26A) of USP2a in Complex with Ubiquitin
6SQO 1.41 Å, Crystal structure of human MDM2 RING domain homodimer bound to UbcH5B-Ub
7F0N 1.6 Å, Structure of deamidated Ubiquitin
8GLP 1.67 Å, mRNA decoding in human is kinetically and structurally distinct from bacteria (Consensus…
3NS8 1.71 Å, Crystal structure of an open conformation of Lys48-linked diubiquitin at pH 7.5
3N32 1.79 Å, The crystal structure of human Ubiquitin adduct with Zeise's salt
6SQS 1.83 Å, Crystal structure of cat phospho-Ser429 MDM2 RING domain bound to UbcH5B-Ub
8QOI 1.9 Å, Structure of the human 80S ribosome at 1.9 A resolution - the molecular role of chemical…
9O3W 1.9 Å, Human 80S ribosome bound to IDB-001 stalled on MYC nascent chain
5WVO 2.0 Å, Crystal structure of DNMT1 RFTS domain in complex with K18/K23 mono-ubiquitylated…
3PHW 2.0 Å, OTU Domain of Crimean Congo Hemorrhagic Fever Virus in complex with Ubiquitin
8YOO 2.0 Å, Cryo-EM structure of the human 80S ribosome with 100 um Tigecycline

Browse structure collections

About this viewer

MolViewer shows 3AXC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.