Catalytic fragment of human fibroblast collagenase complexed with cgs-27023A, NMR, minimized average structure. Determined by solution NMR. Released 7 Jun 1999.
Explore 3AYK in 3D Show helices and sheets RCSB PDB PDBe
3AYK contains 5 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 13-18 | 6 | 1 |
| α-helix | 27-44 | 18 | |
| β-strand | 48-51 | 4 | 1 |
| β-strand | 59-64 | 6 | 1 |
| β-strand | 75 | 1 | 2 |
| β-strand | 78 | 1 | 2 |
| β-strand | 82-84 | 3 | 1 |
| β-strand | 95-98 | 4 | 1 |
| α-helix | 102-103 | 2 | |
| α-helix | 112-123 | 12 | |
| α-helix | 126-128 | 3 | |
| α-helix | 150-159 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein (collagenase) | A | protein | 169 | Homo sapiens | P03956 (AlphaFold model) |
>3AYK_1 PROTEIN (COLLAGENASE) (chains A) VLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIM ISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHEL GHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQP
| ID | Name | Formula | Copies |
|---|---|---|---|
| CGS | N-hydroxy-2(R)-[[(4-METHOXYPHENYL)SULFONYL](3-picolyl)amino]-3-methylbutanamide… | C18 H23 N3 O5 S | 1 |
| CA | Calcium ion | Ca | 1 |
| ZN | Zinc ion | Zn | 2 |
NMR solution structure of the catalytic fragment of human fibroblast collagenase complexed with a sulfonamide derivative of a hydroxamic acid compound. Moy, F.J., Chanda, P.K., Chen, J.M. et al. Biochemistry (1999) 38:7085-7096. DOI 10.1021/bi982576v · PubMed
Other PDB entries of the same protein (UniProt P03956 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3AYK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.