Crystal structure of the UBA domain of p62 and its interaction with ubiquitin. Determined by X-ray diffraction at 1.4 Å resolution. Released 29 Jun 2011.
Explore 3B0F in 3D Show helices and sheets RCSB PDB PDBe
3B0F contains 8 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-20 | 12 | |
| α-helix | 26-28 | 3 | |
| α-helix | 29-36 | 8 | |
| α-helix | 41-47 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sequestosome-1 | A, B | protein | 53 | Mus musculus | Q64337 (AlphaFold model) |
>3B0F_1 Sequestosome-1 (chains A, B) GPLGSEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKH
Crystal structure of the ubiquitin-associated (UBA) domain of p62 and its interaction with ubiquitin. Isogai, S., Morimoto, D., Arita, K. et al. J Biol Chem (2011) 286:31864-31874. DOI 10.1074/jbc.M111.259630 · PubMed
Other PDB entries of the same protein (UniProt Q64337 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3B0F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.