3BCH: Human Laminin Receptor Precursor

Crystal Structure of the Human Laminin Receptor Precursor. Determined by X-ray diffraction at 2.15 Å resolution. Released 4 Dec 2007.

Method: X-ray diffraction
Resolution: 2.15 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,710
Mol. weight: 28.21 kDa
Released: 4 Dec 2007

Explore 3BCH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3BCH contains 11 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	12-21	10
β-strand	25	1	1
α-helix	32-37	6
β-strand	38-41	4	1
α-helix	46	1
β-strand	47-49	3	1
α-helix	51-66	16
α-helix	71-73	3
β-strand	74-78	5	2
α-helix	81-94	14
α-helix	96	1
β-strand	97-100	4	2
β-strand	121-124	4	2
α-helix	131-139	9
β-strand	144-148	5	2
β-strand	159-162	4	2
α-helix	168-186	19
α-helix	194-195	2
α-helix	199-202	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
40S ribosomal protein SA	A	protein	253	Homo sapiens	P08865 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3BCH_1 40S ribosomal protein SA (chains A)
MGSSHHHHHHSSGLVPRGSGTENLYFQGHMASGSSGALDVLQMKEEDVLKFLAAGTHLGG
TNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAV
LKFAAATGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIAL
CNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDP
EEIEKEEQAAAEK

Primary citation

Crystal structure of the human laminin receptor precursor. Jamieson, K.V., Wu, J., Hubbard, S.R. et al. J Biol Chem (2008) 283:3002-3005. DOI 10.1074/jbc.C700206200 · PubMed

Other PDB entries of the same protein (UniProt P08865 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8GLP 1.67 Å, mRNA decoding in human is kinetically and structurally distinct from bacteria (Consensus…
8QOI 1.9 Å, Structure of the human 80S ribosome at 1.9 A resolution - the molecular role of chemical…
9O3W 1.9 Å, Human 80S ribosome bound to IDB-001 stalled on MYC nascent chain
8YOO 2.0 Å, Cryo-EM structure of the human 80S ribosome with 100 um Tigecycline
9C3H 2.0 Å, Structure of the CNOT3-bound human 80S ribosome with tRNA-ARG in the P-site.
29IZ 2.08 Å, Dormant 80S:eEF2:SERBP1:tRNA complex from human cells treated with toxin NT-2
9TV2 2.1 Å, 80S ribosomes from primary B-cells infected with delta v-snoRNA1 EBV
7R4X 2.15 Å, Cryo-EM reconstruction of the human 40S ribosomal subunit - Full map
9I2D 2.19 Å, NMT1-NAC bound human RNC with 10 amino acid ARF1-linker
9PBE 2.19 Å, In situ human 80S ribosome (composite map)
8YOP 2.2 Å, Cryo-EM structure of the human 80S ribosome with 4 um Tigecycline
9O3Y 2.2 Å, Human 80S ribosome bound to IDB-002 stalled on FPAK-containing nascent chain

Browse structure collections

About this viewer

MolViewer shows 3BCH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.