Crystal structure of SR protein kinase 1 complexed to its substrate ASF/SF2. Determined by X-ray diffraction at 2.9 Å resolution. Released 1 Apr 2008.
Explore 3BEG in 3D Show helices and sheets RCSB PDB PDBe
3BEG contains 23 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 75-76 | 2 | 1 |
| β-strand | 80-88 | 9 | 1 |
| β-strand | 92-99 | 8 | 1 |
| β-strand | 105-111 | 7 | 1 |
| α-helix | 115-132 | 18 | |
| β-strand | 144 | 1 | 2 |
| α-helix | 145-146 | 2 | |
| β-strand | 147-151 | 5 | 1 |
| β-strand | 154 | 1 | 3 |
| β-strand | 159 | 1 | 3 |
| β-strand | 162-165 | 4 | 1 |
| β-strand | 171 | 1 | 2 |
| α-helix | 172-178 | 7 | |
| α-helix | 186-201 | 16 | |
| α-helix | 202-206 | 5 | |
| β-strand | 209-210 | 2 | 4 |
| α-helix | 216-218 | 3 | |
| β-strand | 219-221 | 3 | 2 |
| α-helix | 225-232 | 8 | |
| α-helix | 485-487 | 3 | |
| β-strand | 493-495 | 3 | 2 |
| β-strand | 502-503 | 2 | 4 |
| α-helix | 515-517 | 3 | |
| α-helix | 520-524 | 5 | |
| α-helix | 531-546 | 16 | |
| α-helix | 561-573 | 13 | |
| α-helix | 576-577 | 2 | |
| α-helix | 578-581 | 4 | |
| α-helix | 587-590 | 4 | |
| β-strand | 591 | 1 | 5 |
| β-strand | 597 | 1 | 5 |
| α-helix | 608-614 | 7 | |
| α-helix | 622-625 | 4 | |
| α-helix | 627-633 | 7 | |
| α-helix | 644-648 | 5 | |
| α-helix | 651-654 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 123-127 | 5 | 6 |
| α-helix | 136-141 | 6 | |
| α-helix | 142-144 | 3 | |
| β-strand | 147-152 | 6 | 6 |
| β-strand | 157-162 | 6 | 6 |
| α-helix | 165-175 | 11 | |
| β-strand | 179 | 1 | 7 |
| β-strand | 189 | 1 | 7 |
| β-strand | 191-194 | 4 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serine/threonine-protein kinase SRPK1 | A | protein | 381 | Homo sapiens | Q96SB4 (AlphaFold model) |
| Splicing factor, arginine/serine-rich 1 | B | protein | 115 | Homo sapiens | Q07955 (AlphaFold model) |
>3BEG_1 Serine/threonine-protein kinase SRPK1 (chains A) DPNDYCKGGYHLVKIGDLFNGRYHVIRKLGWGHFSTVWLSWDIQGKKFVAMKVVKSAEHY TETALDEIRLLKSVRNSDPNDPNREMVVQLLDDFKISGVNGTHICMVFEVLGHHLLKWII KSNYQGLPLPCVKKIIQQVLQGLDYLHTKCRIIHTDIKPENILLSVNEQYIRRLAAEATE WQRSGAPPPSGSAVSTAPATAGNFLVNPLEPKNAEKLKVKIADLGNACWVHKHFTEDIQT RQYRSLEVLIGSGYNTPADIWSTACMAFELATGDYLFEPHSGEEYTRDEDHIALIIELLG KVPRKLIVAGKYSKEFFTKKGDLKHITKLKPWGLFEVLVEKYEWSQEEAAGFTDFLLPML ELIPEKRATAAECLRHPWLNS
>3BEG_2 Splicing factor, arginine/serine-rich 1 (chains B) GGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVR KEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRS
| ID | Name | Formula | Copies |
|---|---|---|---|
| SEP | Phosphoserine | C3 H8 N O6 P | 1 |
| ALA | Alanine | C3 H7 N O2 | 1 |
| ANP | Phosphoaminophosphonic acid-adenylate ester | C10 H17 N6 O12 P3 | 1 |
A sliding docking interaction is essential for sequential and processive phosphorylation of an SR protein by SRPK1. Ngo, J.C., Giang, K., Chakrabarti, S. et al. Mol Cell (2008) 29:563-576. DOI 10.1016/j.molcel.2007.12.017 · PubMed
Other PDB entries of the same protein (UniProt Q96SB4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3BEG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.