3BQO: TRF1 TRFH domain and TIN2 peptide complex

Crystal Structure of TRF1 TRFH domain and TIN2 peptide complex. Determined by X-ray diffraction at 2.0 Å resolution. Released 19 Feb 2008.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,874
Mol. weight: 26.69 kDa
Released: 19 Feb 2008

Explore 3BQO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3BQO contains 10 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	63-92	30
α-helix	95-110	16
α-helix	117-133	17
β-strand	140-141	2	1
α-helix	150-158	9
α-helix	167-186	20
α-helix	190-200	11
α-helix	211-219	9
α-helix	226-230	5
α-helix	233-251	19
α-helix	255-265	11

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	264-265	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Telomeric repeat-binding factor 1	A	protein	211	Homo sapiens	P54274 (AlphaFold model)
TERF1-interacting nuclear factor 2	B	protein	21	Homo sapiens	Q9BSI4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3BQO_1 Telomeric repeat-binding factor 1 (chains A)
EEEEEDAGLVAEAEAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRNSAEAIIHGLSSLTA
CQLRTIYICQFLTRIAAGKTLDAQFENDERITPLESALMIWGSIEKEHDKLHEEIQNLIK
IQAIAVCMENGNFKEAEEVFERIFGDPNSHMPFKSKLLMIISQKDTFHSFFQHFSYNHMM
EKIKSYVNYVLSEKSSTFLMKAAAKVVESKR

Sequence of entity 2 (B), FASTA

>3BQO_2 TERF1-interacting nuclear factor 2 (chains B)
SHFNLAPLGRRRVQSQWASTR

Primary citation

A shared docking motif in TRF1 and TRF2 used for differential recruitment of telomeric proteins. Chen, Y., Yang, Y., van Overbeek, M. et al. Science (2008) 319:1092-1096. DOI 10.1126/science.1151804 · PubMed

Other PDB entries of the same protein (UniProt P54274 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9HCZ 1.55 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 6
9HCX 1.69 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 53
9HCP 1.7 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 15
9HCT 1.7 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 50
9HD1 1.73 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 59
9HCL 1.87 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 12
9HD9 1.87 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 1
9HF9 1.9 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 5
9HCN 1.93 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 46
9HCY 1.93 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 54
9HD0 1.93 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 55
9HCR 1.93 Å, Crystal structure of human TRF1 TRFH domain in complex with compound 48

Browse structure collections

About this viewer

MolViewer shows 3BQO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.