Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex. Determined by X-ray diffraction at 2.0 Å resolution. Released 12 May 2009.
Explore 3BVM in 3D Show helices and sheets RCSB PDB PDBe
3BVM contains 10 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-7 | 6 | |
| α-helix | 8-10 | 3 | |
| α-helix | 14-16 | 3 | |
| β-strand | 17 | 1 | 1 |
| α-helix | 22-28 | 7 | |
| β-strand | 33-38 | 6 | 2 |
| β-strand | 42 | 1 | 3 |
| β-strand | 48-51 | 4 | 3 |
| β-strand | 63-67 | 5 | 3 |
| α-helix | 71-78 | 8 | |
| β-strand | 82-86 | 5 | 2 |
| β-strand | 89 | 1 | 3 |
| β-strand | 108-112 | 5 | 3 |
| β-strand | 115-117 | 3 | 2 |
| β-strand | 122 | 1 | 4 |
| α-helix | 127-128 | 2 | |
| β-strand | 129-137 | 9 | 5 |
| β-strand | 140-149 | 10 | 5 |
| β-strand | 151 | 1 | 4 |
| β-strand | 153-155 | 3 | 6 |
| α-helix | 156-171 | 16 | |
| β-strand | 181-189 | 9 | 5 |
| β-strand | 195-199 | 5 | 5 |
| α-helix | 202-203 | 2 | |
| β-strand | 205 | 1 | 1 |
| α-helix | 210-214 | 5 | |
| α-helix | 215-219 | 5 | |
| β-strand | 222-224 | 3 | 6 |
| β-strand | 229-236 | 8 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Enterotoxin type C-3 | A | protein | 237 | Staphylococcus aureus | P0A0L5 (AlphaFold model) |
>3BVM_1 Enterotoxin type C-3 (chains A) ESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKN YDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNKWWPGKTCMYGGITKHEGNH FDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYE TGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex. Cho, S., Swaminathan, C.P., Kerzic, M.C. et al. To be published.
Other PDB entries of the same protein (UniProt P0A0L5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3BVM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.