3BZH: Human ubiquitin-conjugating enzyme E2 E1

Name: PDB 3BZH: Crystal structure of human ubiquitin-conjugating enzyme E2 E1
Published: 2008-02-26
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Crystal structure of human ubiquitin-conjugating enzyme E2 E1. Determined by X-ray diffraction at 1.6 Å resolution. Released 26 Feb 2008.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,375
Mol. weight: 21.58 kDa
Released: 26 Feb 2008

Explore 3BZH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3BZH contains 9 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	22-24	3
α-helix	42-61	20
α-helix	63-64	2
β-strand	67-71	5	1
β-strand	78-84	7	1
α-helix	85-86	2
β-strand	95-101	7	1
α-helix	110-111	2
β-strand	112-115	4	1
β-strand	121	1	2
β-strand	124	1	2
β-strand	129	1	1
β-strand	130	1	2
α-helix	133-135	3
α-helix	145-157	13
α-helix	167-175	9
α-helix	177-191	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-conjugating enzyme E2 E1	A	protein	194	Homo sapiens	P51965 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3BZH_1 Ubiquitin-conjugating enzyme E2 E1 (chains A)
GMSDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKRIQKELADI
TLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRI
YHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAE
HDRMARQWTKRYAT

Primary citation

A human ubiquitin conjugating enzyme (E2)-HECT E3 ligase structure-function screen. Sheng, Y., Hong, J.H., Doherty, R. et al. Mol Cell Proteomics (2012) 11:329-341. DOI 10.1074/mcp.O111.013706 · PubMed

Other PDB entries of the same protein (UniProt P51965 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5LBN 1.42 Å, High-resolution crystal structure of the UBC core domain of UBE2E1/UbcH6
1XR9 1.79 Å, Crystal Structures of HLA-B*1501 in Complex with Peptides from Human UbcH6 and…
4JJQ 1.95 Å, Crystal structure of usp7-ntd with an e2 enzyme
8IYA 2.43 Å, Complex of SETDB1-derived peptide bound to UBE2E1
6FGA 2.82 Å, Crystal structure of TRIM21 E3 ligase, RING domain in complex with its cognate E2…

Browse structure collections

About this viewer

MolViewer shows 3BZH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.