4JJQ: Usp7-ntd with an e2 enzyme

Crystal structure of usp7-ntd with an e2 enzyme. Determined by X-ray diffraction at 1.95 Å resolution. Released 1 May 2013.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,232
Mol. weight: 19.46 kDa
Released: 1 May 2013

Explore 4JJQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4JJQ contains 5 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	68-75	8	1
α-helix	78-80	3
β-strand	85-86	2	2
α-helix	87-89	3
β-strand	90-92	3	2
β-strand	95-104	10	2
β-strand	113-121	9	2
β-strand	131-140	10	1
α-helix	146-148	3
β-strand	150-159	10	1
β-strand	162	1	1
β-strand	164-172	9	2
α-helix	173-176	4
β-strand	185	1	3
β-strand	188	1	3
β-strand	189-197	9	1
α-helix	198-200	3
β-strand	201	1	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	13	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin carboxyl-terminal hydrolase 7	A	protein	159	Homo sapiens	Q93009 (AlphaFold model)
Ubiquitin-conjugating enzyme E2 E1	B	protein	10	Homo sapiens	P51965 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4JJQ_1 Ubiquitin carboxyl-terminal hydrolase 7 (chains A)
GSMTAEEDMEDDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRP
HQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNF
MAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAWASTS

Sequence of entity 2 (B), FASTA

>4JJQ_2 Ubiquitin-conjugating enzyme E2 E1 (chains B)
DSRASTSSSS

Primary citation

Ubiquitin-specific protease 7 is a regulator of ubiquitin-conjugating enzyme UbE2E1. Sarkari, F., Wheaton, K., La Delfa, A. et al. J Biol Chem (2013) 288:16975-16985. DOI 10.1074/jbc.M113.469262 · PubMed

Other PDB entries of the same protein (UniProt Q93009 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4YSI 1.02 Å, Structure of USP7 with a novel viral protein
5KYC 1.43 Å, Crystal structure of USP7 catalytic domain [V302K] mutant in complex with ubiquitin…
5KYF 1.45 Å, Crystal structure of USP7 catalytic domain [L299A] mutant in complex with ubiquitin
2FOJ 1.6 Å, The Crystal Structure of the N-terminal domain of HAUSP/USP7 complexed with p53 peptide…
2XXN 1.6 Å, Structure of the vIRF4-HAUSP TRAF domain complex
5KYD 1.62 Å, Crystal structure of USP7 catalytic domain [V302K] mutant in complex with ubiquitin
12ZJ 1.63 Å, Crystal structure of USP7 TRAF domain in complex with MAGEL2 peptide (968-980)
2F1W 1.65 Å, Crystal structure of the TRAF-like domain of HAUSP/USP7
1YY6 1.7 Å, The Crystal Structure of the N-terminal domain of HAUSP/USP7 complexed with an EBNA1…
2F1Y 1.7 Å, Crystal structure of the TRAF-like domain of HAUSP/USP7 bound to a MDM2 peptide
4KG9 1.7 Å, Crystal Structure Of USP7-NTD with MCM-BP
5N9T 1.73 Å, Crystal structure of USP7 in complex with a potent, selective and reversible…

Browse structure collections

About this viewer

MolViewer shows 4JJQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.