3C0O: Proaerolysin mutant Y221G

Crystal structure of the proaerolysin mutant Y221G complexed with mannose-6-phosphate. Determined by X-ray diffraction at 2.5 Å resolution. Released 12 Feb 2008.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Aeromonas hydrophila
Chains: 2
Atoms: 7,247
Mol. weight: 104.33 kDa
Ligands: M6P
Released: 12 Feb 2008

Explore 3C0O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3C0O contains 39 α-helices and 63 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 33 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
β-strand	10-12	3	1
β-strand	23-25	3	1
α-helix	26-27	2
α-helix	28-33	6
α-helix	35-39	5
β-strand	47-50	4	1
β-strand	54-57	4	1
α-helix	59-61	3
β-strand	65-67	3	1
β-strand	73-77	5	1
α-helix	84-86	3
α-helix	88-90	3
β-strand	91-93	3	2
α-helix	98-106	9
α-helix	109-113	5
α-helix	114-122	9
β-strand	125	1	3
β-strand	135	1	4
β-strand	140-144	5	2
β-strand	149-153	5	2
β-strand	169-186	18	2
β-strand	191-206	16	2
β-strand	212	1	5
β-strand	215-223	9	6
β-strand	225-229	5	2
α-helix	235-237	3
β-strand	240	1	2
β-strand	245-246	2	7
β-strand	258-259	2	7
α-helix	265-267	3
β-strand	270-272	3	2
β-strand	275-276	2	6
β-strand	279-281	3	6
β-strand	285	1	5
β-strand	289-321	33	2
β-strand	322	1	3
α-helix	323	1
β-strand	329	1	8
β-strand	338-345	8	2
α-helix	351-353	3
α-helix	355-360	6
α-helix	365-367	3
β-strand	371	1	8
α-helix	373-380	8
α-helix	382-392	11
β-strand	396-411	16	2
α-helix	413-414	2
β-strand	415-416	2	2
β-strand	420-421	2	2
β-strand	442-444	3	2
α-helix	449-454	6
β-strand	457-466	10	6

Chain B: 19 helices, 30 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
β-strand	10-12	3	9
β-strand	23-25	3	9
α-helix	26-27	2
α-helix	28-33	6
α-helix	35-39	5
β-strand	47-50	4	9
β-strand	54-57	4	9
α-helix	59-61	3
β-strand	65-67	3	9
β-strand	73-77	5	9
α-helix	84-86	3
β-strand	91-93	3	10
α-helix	98-106	9
α-helix	109-113	5
α-helix	114-122	9
β-strand	125	1	11
β-strand	140-145	6	10
β-strand	148-153	6	10
β-strand	169-186	18	10
β-strand	191-205	15	10
β-strand	215-222	8	12
β-strand	225-229	5	10
α-helix	235-238	4
β-strand	239-240	2	10
β-strand	245-246	2	13
α-helix	247-249	3
β-strand	258-259	2	13
α-helix	260	1
α-helix	265-267	3
β-strand	270-273	4	10
β-strand	276-281	6	12
β-strand	289-321	33	10
β-strand	322	1	11
α-helix	323	1
β-strand	329	1	14
β-strand	338-345	8	10
α-helix	351-353	3
α-helix	355-360	6
α-helix	365-367	3
β-strand	371	1	14
α-helix	373-392	20
β-strand	396-411	16	10
β-strand	415-416	2	10
β-strand	417	1	4
β-strand	420-421	2	10
β-strand	442-444	3	10
α-helix	449-455	7
β-strand	458-466	9	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Aerolysin	A, B	protein	470	Aeromonas hydrophila	P09167 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3C0O_1 Aerolysin (chains A, B)
AEPVYPDQLRLFSLGQGVCGDKYRPVNREEAQSVKSNIVGMMGQWQISGLANGWVIMGPG
YNGEIKPGTASNTWCYPTNPVTGEIPTLSALDIPDGDEVDVQWRLVHDSANFIKPTSYLA
HYLGYAWVGGNHSQYVGEDMDVTRDGDGWVIRGNNDGGCDGYRCGDKTAIKVSNFAYNLD
PDSFKHGDVTQSDRQLVKTVVGWAVNDSDTPQSGYDVTLRGDTATNWSKTNTYGLSEKVT
TKNKFKWPLVGETELSIEIAANQSWASQNGGSTTTSLSQSVRPTVPARSKIPVKIELYKA
DISYPYEFKADVSYDLTLSGFLRWGGNAWYTHPDNRPNWNHTFVIGPYKDKASSIRYQWD
KRYIPGEVKWWDWNWTIQQNGLSTMQNNLARVLRPVRAGITGDFSAESQFAGNIEIGAPV
PLAADSKVRRARSVDGAGQGLRLEIPLDAQELSGLGFNNVSLSVTPAANQ

Ligands and cofactors

ID	Name	Formula	Copies
M6P	6-O-phosphono-alpha-D-mannopyranose	C6 H13 O9 P	2

Water and common crystallization additives (ACT) are not listed.

Primary citation

Molecular assembly of the aerolysin pore reveals a swirling membrane-insertion mechanism. Degiacomi, M.T., Iacovache, I., Pernot, L. et al. Nat Chem Biol (2013) 9:623-629. DOI 10.1038/nchembio.1312 · PubMed

Other PDB entries of the same protein (UniProt P09167 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3G4N 2.1 Å, Crystal structure of the activated aerolysin mutant H132D
9FNQ 2.1 Å, Aerolysin double mutant K238A/K244A in styrene-maleic acid lipid particles
3C0N 2.2 Å, Crystal structure of the proaerolysin mutant Y221G at 2.2 A
9FM6 2.2 Å, Aerolysin Wildtype in styrene-maleic acid lipid particles
9FML 2.2 Å, Aerolysin heptamer in membrane inserted form reconstituted in amphipoles.
9FMX 2.2 Å, Aerolysin Y221G - prepore
9FNP 2.2 Å, Aerolysin mutant K238A in styrene-maleic acid lipid particles
3G4O 2.3 Å, Crystal structure of the activated aerolysin mutant H132N
9GXJ 2.3 Å, Aerolysin E254A/E258A in styrene-maleic acid lipid particles
9IGN 2.3 Å, Aerolysin E254A/E258A in styrene-maleic acid lipid particles
1Z52 2.38 Å, Proaerolysin Mutant W373L
1PRE 2.8 Å, Proaerolysin

Browse structure collections

About this viewer

MolViewer shows 3C0O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.