Crystal structure of Vps75. Determined by X-ray diffraction at 2.0 Å resolution. Released 12 Aug 2008.
Explore 3C9D in 3D Show helices and sheets RCSB PDB PDBe
3C9D contains 25 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-51 | 43 | |
| α-helix | 57-64 | 8 | |
| α-helix | 68-71 | 4 | |
| α-helix | 74-76 | 3 | |
| α-helix | 77-80 | 4 | |
| β-strand | 83-90 | 8 | 1 |
| α-helix | 91-93 | 3 | |
| β-strand | 103-109 | 7 | 1 |
| β-strand | 112 | 1 | 2 |
| β-strand | 116 | 1 | 2 |
| β-strand | 119-128 | 10 | 1 |
| β-strand | 138-141 | 4 | 1 |
| α-helix | 147-149 | 3 | |
| α-helix | 150-152 | 3 | |
| α-helix | 166-176 | 11 | |
| α-helix | 179-182 | 4 | |
| α-helix | 197-203 | 7 | |
| α-helix | 204-208 | 5 | |
| α-helix | 209-220 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 12-51 | 40 | |
| α-helix | 57-64 | 8 | |
| α-helix | 68-71 | 4 | |
| α-helix | 74-76 | 3 | |
| α-helix | 77-80 | 4 | |
| β-strand | 83-90 | 8 | 3 |
| α-helix | 91-93 | 3 | |
| β-strand | 103-109 | 7 | 3 |
| β-strand | 112 | 1 | 4 |
| β-strand | 116 | 1 | 4 |
| β-strand | 119-128 | 10 | 3 |
| β-strand | 138-141 | 4 | 3 |
| α-helix | 150-155 | 6 | |
| α-helix | 166-176 | 11 | |
| α-helix | 179-182 | 4 | |
| α-helix | 197-203 | 7 | |
| α-helix | 204-208 | 5 | |
| α-helix | 209-220 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Vacuolar protein sorting-associated protein 75 | A, B | protein | 259 | Saccharomyces cerevisiae | P53853 (AlphaFold model) |
>3C9D_1 Vacuolar protein sorting-associated protein 75 (chains A, B) MMSDQENENEHAKAFLGLAKCEEEVDAIEREVELYRLNKMKPVYEKRDAYIDEIAEFWKI VLSQHVSFANYIRASDFKYIDTIDKIKVEWLALESEMYDTRDFSITFHFHGIEGDFKEQQ VTKVFQIKKGKDDQEDGILTSEPVPIEWPQSYDSINPDLIKDKRSPEGKKKYRQGMKTIF GWFRWTGLKPGKEFPHGDSLASLFSEEIYPFCVKYYAEAQRDLEDEEGESGLSADGDSED DDGSLGEVDLPLSDEEPSS
Molecular functions of the histone acetyltransferase chaperone complex Rtt109-Vps75. Berndsen, C.E., Tsubota, T., Lindner, S.E. et al. Nat Struct Mol Biol (2008) 15:948-956. DOI 10.1038/nsmb.1459 · PubMed
Other PDB entries of the same protein (UniProt P53853 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3C9D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.