N1 Neuraminidase H274Y + oseltamivir. Determined by X-ray diffraction at 2.2 Å resolution. Released 20 May 2008.
Explore 3CL0 in 3D Show helices and sheets RCSB PDB PDBe
3CL0 contains 7 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 90 | 1 | |
| β-strand | 91 | 1 | 1 |
| α-helix | 92-93 | 2 | |
| β-strand | 96-102 | 7 | 2 |
| α-helix | 105-108 | 4 | |
| β-strand | 115-124 | 10 | 3 |
| β-strand | 129-139 | 11 | 3 |
| α-helix | 143-145 | 3 | |
| β-strand | 157-162 | 6 | 3 |
| α-helix | 171 | 1 | |
| β-strand | 172-176 | 5 | 3 |
| β-strand | 179-184 | 6 | 4 |
| β-strand | 189-195 | 7 | 4 |
| β-strand | 202-207 | 6 | 4 |
| β-strand | 210-216 | 7 | 4 |
| β-strand | 224 | 1 | 5 |
| β-strand | 229 | 1 | 4 |
| β-strand | 231-233 | 3 | 5 |
| β-strand | 236-243 | 8 | 5 |
| β-strand | 251-258 | 8 | 5 |
| β-strand | 261-267 | 7 | 5 |
| β-strand | 279-283 | 5 | 6 |
| β-strand | 286-290 | 5 | 6 |
| α-helix | 300 | 1 | |
| β-strand | 301-306 | 6 | 6 |
| β-strand | 312-316 | 5 | 6 |
| β-strand | 352-356 | 5 | 7 |
| β-strand | 359-364 | 6 | 7 |
| β-strand | 372-379 | 8 | 7 |
| β-strand | 392-403 | 11 | 7 |
| β-strand | 407-412 | 6 | 2 |
| α-helix | 412B-413 | 4 | |
| β-strand | 418 | 1 | 1 |
| β-strand | 419-429 | 11 | 2 |
| β-strand | 439-449 | 11 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Neuraminidase | A | protein | 385 | Influenza A virus | Q6DPL2 |
>3CL0_1 Neuraminidase (chains A) VKLAGNSSLCPINGWAVYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGALLND KHSNGTVKDRSPHRTLMSCPVGEAPSPYNSRFESVAWSASACHDGTSWLTIGISGPDNGA VAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNGQASYKIFKMEKGK VVKSVELDAPNYYYEECSCYPNAGEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICSGVF GDNPRPNDGTGSCGPVSSNGAYGVKGFSFKYGNGVWIGRTKSTNSRSGFEMIWDPNGWTE TDSSFSVKQDIVAITDWSGYSGSFVQHPELTGLDCIRPCFWVELIRGRPKESTIWTSGSS ISFCGVNSDTVGWSWPDGAELPFTI
| ID | Name | Formula | Copies |
|---|---|---|---|
| G39 | (3R,4R,5S)-4-(acetylamino)-5-amino-3-(pentan-3-yloxy)cyclohex-1-ene-1-carboxyli… | C14 H24 N2 O4 | 1 |
| CA | Calcium ion | Ca | 1 |
Crystal structures of oseltamivir-resistant influenza virus neuraminidase mutants. Collins, P.J., Haire, L.F., Lin, Y.P. et al. Nature (2008) 453:1258-1261. DOI 10.1038/nature06956 · PubMed
Other PDB entries of the same protein (UniProt Q6DPL2), best resolution first:
MolViewer shows 3CL0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.