3CO1: Microtubule binding domain of human EB3

Crystal structure of microtubule binding domain of human EB3. Determined by X-ray diffraction at 1.4 Å resolution. Released 17 Mar 2009.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,248
Mol. weight: 15.4 kDa
Released: 17 Mar 2009

Explore 3CO1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3CO1 contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	0-4	5
α-helix	12-16	5
α-helix	17-28	12
α-helix	35-40	6
α-helix	42-51	10
α-helix	58-60	3
α-helix	68-85	18
α-helix	89-91	3
α-helix	93-97	5
α-helix	101-118	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Microtubule-associated protein RP/EB family member 3	A	protein	132	Homo sapiens	Q9UPY8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3CO1_1 Microtubule-associated protein RP/EB family member 3 (chains A)
GSMAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHL
RKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDAN
YDGKDYNPLLAR

Primary citation

Mammalian end binding proteins control persistent microtubule growth. Komarova, Y., De Groot, C.O., Grigoriev, I. et al. J Cell Biol (2009). DOI 10.1083/jcb.200807179 · PubMed

Other PDB entries of the same protein (UniProt Q9UPY8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3TQ7 2.3 Å, EB1c/EB3c heterodimer in complex with the CAP-Gly domain of P150glued
3JAK 3.3 Å, Cryo-EM structure of GTPgammaS-microtubule co-polymerized with EB3 (merged dataset with…
3JAR 3.4 Å, Cryo-EM structure of GDP-microtubule co-polymerized with EB3
3JAL 3.5 Å, Cryo-EM structure of GMPCPP-microtubule co-polymerized with EB3
7SJ9 3.8 Å, 13pf E254A microtubule from recombinant human tubulin decorated with EB3
9F3S 4.2 Å, 13pf mosaic 20%E254Q - 80% E254N microtubule from recombinant human tubulin decorated…
9F3R 4.3 Å, 13pf E254Q microtubule from recombinant human tubulin decorated with EB3
1WYO Solution structure of the CH domain of human microtubule-associated protein RP/EB family…

Browse structure collections

About this viewer

MolViewer shows 3CO1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.