3CQG: Nuclear pore complex protein Nup107

Nucleoporin Nup107/Nup133 interaction complex, delta finger mutant. Determined by X-ray diffraction at 3.0 Å resolution. Released 1 Jul 2008.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,285
Mol. weight: 54.37 kDa
Released: 1 Jul 2008

Explore 3CQG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3CQG contains 26 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	667-678	12
α-helix	682-684	3
α-helix	685-701	17
α-helix	705-713	9
α-helix	719-725	7
α-helix	738-769	32
α-helix	801-821	21
α-helix	837-838	2
α-helix	840-866	27
α-helix	871-875	5
α-helix	877-882	6
α-helix	888-891	4
α-helix	894-912	19

Chain B: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	937-942	6
α-helix	946-959	14
α-helix	964-980	17
α-helix	985-999	15
α-helix	1002-1006	5
α-helix	1010-1015	6
α-helix	1028-1036	9
α-helix	1045-1053	9
α-helix	1054-1057	4
α-helix	1066-1081	16
α-helix	1096-1104	9
α-helix	1125-1128	4
α-helix	1141-1155	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear pore complex protein Nup107	A	protein	246	Homo sapiens	P57740 (AlphaFold model)
Nuclear pore complex protein Nup133	B	protein	227	Homo sapiens	Q8WUM0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3CQG_1 Nuclear pore complex protein Nup107 (chains A)
GSPALDTGTTEEDRLKIDVIDWLVFDPAQRAEALKQGNAIMRKFLASKKHEAAKEVFVKI
PQDSIAEIYNQCEEQGMESPLPAEDDNAIREHLCIRAYLEAHETFNEWFKHMNSVPGGSG
GSWKGHLDALTADVKEKMYNVLLFVDGGWMVDVREDAKEDHERTHQMVLLRKLCLPMLCF
LLHTILHSTGQYQECLQLADMVSSERHKLYLVFSKEELRKLLQKLRESSLMLLDQGLDPL
GYEIQL

Sequence of entity 2 (B), FASTA

>3CQG_2 Nuclear pore complex protein Nup133 (chains B)
MASHHLSWLHEINSQELEKAHATLLGLANMETRYFAKKKTLLGLSKLAALASDFSEDMLQ
EKIEEMAEQERFLLHQETLPEQLLAEKQLNLSAMPVLTAPQLIGLYICEENRRANEYDFK
KALDLLEYIDEEEDININDLKLEILCKALQRDNWSSSDGKDDPIEVSKDSIFVKILQKLL
KDGIQLSEYLPEVKDLLQADQLGSLKSNPYFEFVLKANYEYYVQGQI

Primary citation

Structural and functional studies of Nup107/Nup133 interaction and its implications for the architecture of the nuclear pore complex. Boehmer, T., Jeudy, S., Berke, I.C. et al. Mol Cell (2008) 30:721-731. DOI 10.1016/j.molcel.2008.04.022 · PubMed

Other PDB entries of the same protein (UniProt P57740 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CQC 2.53 Å, Nucleoporin Nup107/Nup133 interaction complex
3I4R 3.53 Å, Nup107(aa658-925)/Nup133(aa517-1156) complex, H.sapiens
7R5K 12.0 Å, Human nuclear pore complex (constricted)
5A9Q 23.0 Å, Human nuclear pore complex
7PEQ 35.0 Å, Model of the outer rings of the human nuclear pore complex
7R5J 50.0 Å, Human nuclear pore complex (dilated)
9A25 Molecular assembly pathway of the human Nuclear Pore Complex after cell division
9A8T Integrative spatiotemporal modeling of biomolecular processes: application to the…

Browse structure collections

About this viewer

MolViewer shows 3CQG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.