3DAD: FH1/FH2 domain-containing protein 1

Crystal structure of the N-terminal regulatory domains of the formin FHOD1. Determined by X-ray diffraction at 2.3 Å resolution. Released 16 Sept 2008.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,072
Mol. weight: 74.55 kDa
Released: 16 Sept 2008

Explore 3DAD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3DAD contains 43 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	15-22	8	1
α-helix	31-32	2
β-strand	42-46	5	1
α-helix	51-53	3
α-helix	55-62	8
β-strand	71-75	5	1
α-helix	80	1
β-strand	81	1	1
α-helix	82	1
α-helix	98-100	3
α-helix	102-104	3
β-strand	109-114	6	1
α-helix	116-129	14
α-helix	132-147	16
α-helix	152-158	7
α-helix	161-169	9
α-helix	174-187	14
α-helix	191-199	9
α-helix	201-209	9
α-helix	210-212	3
α-helix	216-232	17
α-helix	234-236	3
α-helix	237-251	15
α-helix	253-254	2
α-helix	257-263	7
α-helix	271-287	17
α-helix	291-303	13
α-helix	306-314	9
α-helix	321-338	18

Chain B: 19 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	18	1	2
β-strand	20-22	3	3
β-strand	43	1	2
α-helix	51-53	3
α-helix	55-61	7
β-strand	71-75	5	3
β-strand	81	1	3
α-helix	89-91	3
β-strand	110-114	5	3
α-helix	116-129	14
α-helix	132-147	16
α-helix	152-158	7
α-helix	161-169	9
α-helix	174-188	15
α-helix	191-198	8
α-helix	201-210	10
α-helix	216-232	17
α-helix	234-236	3
α-helix	237-251	15
α-helix	253-254	2
α-helix	257-264	8
α-helix	271-286	16
α-helix	291-302	12
α-helix	306-315	10
α-helix	321-338	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
FH1/FH2 domain-containing protein 1	A, B	protein	339	Homo sapiens	Q9Y613 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3DAD_1 FH1/FH2 domain-containing protein 1 (chains A, B)
MAGGEDRGDGEPVSVVTVRVQYLEDTDPFASANFPEPRRAPTCSLDGALPLGAQIPAVHR
LLGAPLKLEDSALQVSPSGYYLDTELSLEEQREMLEGFYEEISKGRKPTLILRTQLSVRV
NAILEKLYSSSGPELRRSLFSLKQIFQEDKDLVPEFVHSEGLSCLIRVGAAADHNYQSYI
LRALGQLMLFVDGMLGVVAHSDTIQWLYTLCASLSRLVVKTALKLLLVFVEYSENNAPLF
IRAVNSVASTTGAPPWANLVSILEEKNGADPELLVYTVTLINKTLAALPDQDSFYDVTDA
LEQQGMEALVQRHLGTAGTDVDLRTQLVLYENALKLEDG

Primary citation

The Human Formin FHOD1 Contains a Bipartite Structure of FH3 and GTPase-Binding Domains Required for Activation. Schulte, A., Stolp, B., Schonichen, A. et al. Structure (2008) 16:1313-1323. DOI 10.1016/j.str.2008.06.008 · PubMed

Other PDB entries of the same protein (UniProt Q9Y613 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6XF1 2.8 Å, Nesprin-2G(aa1425-1649)-FHOD1(aa1-339) complex, H. sapiens
6XF2 7.11 Å, Nesprin-1G (aa2070-2200)-FHOD1(aa1-339) complex, H. sapiens

Browse structure collections

About this viewer

MolViewer shows 3DAD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.