6XF2: Nesprin-1

Nesprin-1G (aa2070-2200)-FHOD1(aa1-339) complex, H. sapiens. Determined by X-ray diffraction at 7.11 Å resolution. Released 3 Feb 2021.

Method: X-ray diffraction
Resolution: 7.11 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,075
Mol. weight: 101.5 kDa
Released: 3 Feb 2021

Explore 6XF2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6XF2 contains 51 α-helices and 14 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	2071-2107	37
α-helix	2118-2150	33
α-helix	2166-2196	31

Chain B: 21 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	15-22	8	1
α-helix	28-30	3
β-strand	42-46	5	1
β-strand	50	1	2
α-helix	52-54	3
α-helix	55-62	8
α-helix	68-70	3
β-strand	71-75	5	1
β-strand	81	1	1
β-strand	87	1	2
α-helix	92-94	3
α-helix	96-103	8
β-strand	109-114	6	1
α-helix	116-129	14
α-helix	132-148	17
α-helix	152-158	7
α-helix	161-169	9
α-helix	174-188	15
α-helix	191-199	9
α-helix	201-210	10
α-helix	216-232	17
α-helix	237-251	15
α-helix	254	1
α-helix	257-263	7
α-helix	271-285	15
α-helix	291-304	14
α-helix	306-315	10
α-helix	321-333	13

Chain C: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	2071-2102	32
α-helix	2104-2106	3
α-helix	2120-2155	36
α-helix	2168-2196	29

Chain D: 23 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	15-22	8	3
α-helix	28-30	3
β-strand	42-46	5	3
β-strand	50	1	4
α-helix	52-54	3
α-helix	55-62	8
α-helix	68-70	3
β-strand	71-75	5	3
α-helix	80	1
β-strand	81	1	3
α-helix	82-83	2
β-strand	87	1	4
α-helix	92-94	3
α-helix	96-103	8
β-strand	109-114	6	3
α-helix	116-129	14
α-helix	132-148	17
α-helix	152-158	7
α-helix	161-169	9
α-helix	174-188	15
α-helix	191-199	9
α-helix	201-210	10
α-helix	216-232	17
α-helix	237-251	15
α-helix	254	1
α-helix	257-263	7
α-helix	271-285	15
α-helix	292-304	13
α-helix	306-315	10
α-helix	321-333	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nesprin-1	A, C	protein	131	Homo sapiens	Q8NF91 (AlphaFold model)
FH1/FH2 domain-containing protein 1	B, D	protein	321	Homo sapiens	Q9Y613 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>6XF2_1 Nesprin-1 (chains A, C)
TKRLIHENQGQCCGLIDLMREYQNLKSAVSKVLENASSVIVTRTTIKDQEDLKWAFSKHE
TAKNKMNYKQKDLDNFTSKGKHLLSELKKIHSSDFSLVKTDMESTVDKWLDVSEKLEENM
DRLRVSLSIWD

Sequence of entity 2 (B, D), FASTA

>6XF2_2 FH1/FH2 domain-containing protein 1 (chains B, D)
SVVTVRVQYLEDTDPFACANFPEPRRAPTCSLDGALPLGAQIPAVHRLLGAPLKLEDCAL
QVSPSGYYLDTELSLEEQREMLEGFYEEISKGRKPTLILRTQLSVRVNAILEKLYSSSGP
ELRRSLFSLKQIFQEDKDLVPEFVHSEGLSCLIRVGAAADHNYQSYILRALGQLMLFVDG
MLGVVAHSDTIQWLYTLCASLSRLVVKTALKLLLVFVEYSENNAPLFIRAVNSVASTTGA
PPWANLVSILEEKNGADPELLVYTVTLINKTLAALPDQDSFYDVTDALEQQGMEALVQRH
LGTAGTDVDLRTQLVLYENAL

Primary citation

Structures of FHOD1-Nesprin1/2 complexes reveal alternate binding modes for the FH3 domain of formins. Lim, S.M., Cruz, V.E., Antoku, S. et al. Structure (2021) 29:540-552.e5. DOI 10.1016/j.str.2020.12.013 · PubMed

Other PDB entries of the same protein (UniProt Q8NF91 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6R15 1.82 Å, Crystal structure of the SUN1-KASH1 6:6 complex
4DXR 2.32 Å, Human SUN2-KASH1 complex

Browse structure collections

About this viewer

MolViewer shows 6XF2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.