3DJ1: TIP-1 wild type

crystal structure of TIP-1 wild type. Determined by X-ray diffraction at 1.8 Å resolution. Released 21 Oct 2008.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Mus musculus
Chains: 2
Atoms: 1,877
Mol. weight: 27.58 kDa
Released: 21 Oct 2008

Explore 3DJ1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3DJ1 contains 12 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	14-19	6	1
α-helix	20	1
β-strand	21-23	3	2
β-strand	26-28	3	2
β-strand	31-35	5	1
α-helix	41-43	3
β-strand	55-60	6	1
α-helix	65-69	5
α-helix	75	1
β-strand	76-80	5	1
β-strand	83-84	2	1
α-helix	90-97	8
β-strand	104-110	7	1
α-helix	112-115	4
α-helix	116-122	7

Chain B: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	14-19	6	3
β-strand	21-23	3	4
β-strand	26-28	3	4
β-strand	31-35	5	3
α-helix	41-43	3
β-strand	55-60	6	3
α-helix	65-68	4
β-strand	76-80	5	3
β-strand	83-84	2	3
α-helix	90-97	8
β-strand	104-110	7	3
α-helix	112-114	3
α-helix	115-121	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tax1-binding protein 3	A, B	protein	124	Mus musculus	Q9DBG9 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3DJ1_1 Tax1-binding protein 3 (chains A, B)
MSYTPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRV
SEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQ
SMLS

Primary citation

Structural Basis of beta-Catenin Recognition by Tax-interacting Protein-1. Zhang, J., Yan, X., Shi, C. et al. J Mol Biol (2008) 384:255-263. DOI 10.1016/j.jmb.2008.09.034 · PubMed

Other PDB entries of the same protein (UniProt Q9DBG9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3DIW 2.1 Å, c-terminal beta-catenin bound TIP-1 structure
3DJ3 2.4 Å, Crystal Structure of C-terminal Truncated TIP-1 (6-113)

Browse structure collections

About this viewer

MolViewer shows 3DJ1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.