3DJ3: C-terminal Truncated TIP-1

Crystal Structure of C-terminal Truncated TIP-1 (6-113). Determined by X-ray diffraction at 2.4 Å resolution. Released 21 Oct 2008.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Mus musculus
Chains: 4
Atoms: 3,222
Mol. weight: 50.03 kDa
Released: 21 Oct 2008

Explore 3DJ3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3DJ3 contains 14 α-helices and 33 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	13-19	7	1
α-helix	20	1
β-strand	21-23	3	2
β-strand	26-28	3	2
β-strand	31-35	5	1
α-helix	41-43	3
β-strand	55-60	6	1
α-helix	65-69	5
β-strand	76-80	5	1
β-strand	83-84	2	1
α-helix	90-97	8
β-strand	104-110	7	1

Chain B: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	13-19	7	3
α-helix	20	1
β-strand	21-23	3	4
β-strand	26-28	3	4
β-strand	32-35	4	3
β-strand	55-59	5	3
α-helix	65-69	5
β-strand	76-80	5	3
β-strand	83-84	2	3
α-helix	90-98	9
β-strand	104-110	7	3

Chain C: 2 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	13-19	7	5
β-strand	21-22	2	6
β-strand	27-28	2	6
β-strand	31-35	5	5
α-helix	41-43	3
β-strand	55-60	6	5
β-strand	76-80	5	5
β-strand	84	1	5
α-helix	90-97	8
β-strand	104-110	7	5

Chain D: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	14-19	6	7
α-helix	20	1
β-strand	21-23	3	8
β-strand	26-28	3	8
β-strand	31-35	5	9
α-helix	41-43	3
β-strand	55-60	6	9
α-helix	65-69	5
β-strand	76-77	2	9
β-strand	79-80	2	7
β-strand	84	1	7
α-helix	85-87	3
α-helix	90-97	8
β-strand	104-109	6	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tax1-binding protein 3	A, B, C, D	protein	113	Mus musculus	Q9DBG9 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>3DJ3_1 Tax1-binding protein 3 (chains A, B, C, D)
AMSYTPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTR
VSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQ

Primary citation

Structural Basis of beta-Catenin Recognition by Tax-interacting Protein-1. Zhang, J., Yan, X., Shi, C. et al. J Mol Biol (2008) 384:255-263. DOI 10.1016/j.jmb.2008.09.034 · PubMed

Other PDB entries of the same protein (UniProt Q9DBG9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3DJ1 1.8 Å, crystal structure of TIP-1 wild type
3DIW 2.1 Å, c-terminal beta-catenin bound TIP-1 structure

Browse structure collections

About this viewer

MolViewer shows 3DJ3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.