Crystal structure of the binding domain of the AMPA subunit GluR3 bound to AMPA. Determined by X-ray diffraction at 2.11 Å resolution. Released 25 Nov 2008.
Explore 3DP4 in 3D Show helices and sheets RCSB PDB PDBe
3DP4 contains 17 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-10 | 6 | 1 |
| β-strand | 13 | 1 | 2 |
| β-strand | 17 | 1 | 2 |
| β-strand | 18-19 | 2 | 3 |
| α-helix | 23-25 | 3 | |
| α-helix | 28-31 | 4 | |
| β-strand | 32-33 | 2 | 3 |
| α-helix | 35-47 | 13 | |
| β-strand | 50-55 | 6 | 1 |
| β-strand | 64 | 1 | 4 |
| β-strand | 71 | 1 | 4 |
| α-helix | 73-79 | 7 | |
| β-strand | 85-86 | 2 | 1 |
| α-helix | 90 | 1 | |
| β-strand | 91 | 1 | 5 |
| α-helix | 92 | 1 | |
| α-helix | 94-97 | 4 | |
| β-strand | 100-102 | 3 | 1 |
| α-helix | 103 | 1 | |
| α-helix | 105 | 1 | |
| β-strand | 107-109 | 3 | 5 |
| β-strand | 111-116 | 6 | 6 |
| α-helix | 124-128 | 5 | |
| β-strand | 134-137 | 4 | 6 |
| β-strand | 138 | 1 | 7 |
| α-helix | 142-149 | 8 | |
| α-helix | 153-163 | 11 | |
| β-strand | 171 | 1 | 7 |
| α-helix | 174-183 | 10 | |
| β-strand | 188-193 | 6 | 6 |
| α-helix | 194-201 | 8 | |
| β-strand | 208-211 | 4 | 6 |
| β-strand | 218-220 | 3 | 5 |
| β-strand | 223-225 | 3 | 1 |
| α-helix | 231-243 | 13 | |
| α-helix | 246-251 | 6 | |
| α-helix | 252-256 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Glutamate receptor 3 | A | protein | 278 | Rattus norvegicus | P19492 (AlphaFold model) |
>3DP4_1 Glutamate receptor 3 (chains A) LVPRGSAMGISNDSSRGANRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIA KHVRIKYKLSIVGDGKYGARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSK PFMSLGISIMIKKGTPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKS AEPSVFTKTTADGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVAT PKGSALGTPVNLAVLKLSEQGILDKLKNKWWYDKGECG
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
| AMQ | (s)-alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid | C7 H10 N2 O4 | 1 |
Structure of the S1S2 glutamate binding domain of GLuR3. Ahmed, A.H., Wang, Q., Sondermann, H. et al. Proteins (2008) 75:628-637. DOI 10.1002/prot.22274 · PubMed
Other PDB entries of the same protein (UniProt P19492 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3DP4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.