3DQB: Active G-protein-coupled receptor opsin

Crystal structure of the active G-protein-coupled receptor opsin in complex with a C-terminal peptide derived from the Galpha subunit of transducin. Determined by X-ray diffraction at 3.2 Å resolution. Released 23 Sept 2008.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Bos taurus
Chains: 2
Atoms: 2,866
Mol. weight: 42.86 kDa
Ligands: BOG, PLM
Released: 23 Sept 2008

Explore 3DQB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3DQB contains 18 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	1
β-strand	9-11	3	1
α-helix	15-17	3
α-helix	29-31	3
α-helix	34-64	31
α-helix	66-68	3
α-helix	71-73	3
α-helix	74-85	12
α-helix	86-92	7
α-helix	93-98	6
α-helix	106-140	35
α-helix	150-172	23
β-strand	178-180	3	2
β-strand	187-189	3	2
α-helix	200-208	9
α-helix	209-213	5
α-helix	214-235	22
α-helix	241-275	35
α-helix	289-302	14
α-helix	303-308	6
α-helix	311-321	11

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	341-346	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Rhodopsin	A	protein	348	Bos taurus	P02699 (AlphaFold model)
11meric peptide form Guanine nucleotide-binding protein G(t) subunit alpha-1	B	protein	11		P04695 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3DQB_1 Rhodopsin (chains A)
MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLY
VTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLG
GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIP
EGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQES
ATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAV
YNPVIYIMMNKQFRNCMVTTLCCGKNPLGDDEASTTVSKTETSQVAPA

Sequence of entity 2 (B), FASTA

>3DQB_2 11meric peptide form Guanine nucleotide-binding protein G(t) subunit alpha-1 (chains B)
ILENLKDCGLF

Ligands and cofactors

ID	Name	Formula	Copies
BOG	octyl beta-D-glucopyranoside	C14 H28 O6	3
PLM	Palmitic acid	C16 H32 O2	2

Primary citation

Crystal structure of opsin in its G-protein-interacting conformation. Scheerer, P., Park, J.H., Hildebrand, P.W. et al. Nature (2008) 455:497-502. DOI 10.1038/nature07330 · PubMed

Other PDB entries of the same protein (UniProt P02699 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7ZBC 1.8 Å, Dark state crystal structure of bovine rhodopsin in Lipidic Cubic Phase (SACLA)
7ZBE 1.8 Å, Dark state crystal structure of bovine rhodopsin in Lipidic Cubic Phase (SwissFEL)
8A6C 1.8 Å, 1 picosecond light activated crystal structure of bovine rhodopsin in Lipidic Cubic Phase
8A6D 1.8 Å, 10 picosecond light activated crystal structure of bovine rhodopsin in Lipidic Cubic Phase
8A6E 1.8 Å, 100 picosecond light activated crystal structure of bovine rhodopsin in Lipidic Cubic…
1U19 2.2 Å, Crystal Structure of Bovine Rhodopsin at 2.2 Angstroms Resolution
4X1H 2.29 Å, Opsin/G(alpha) peptide complex stabilized by nonyl-glucoside
5DYS 2.3 Å, Crystal Structure of T94I rhodopsin mutant
6FK6 2.36 Å, Crystal structure of N2C/D282C stabilized opsin bound to RS01
6FKC 2.46 Å, Crystal structure of N2C/D282C stabilized opsin bound to RS15
6FKD 2.49 Å, Crystal structure of N2C/D282C stabilized opsin bound to RS16
1L9H 2.6 Å, Crystal structure of bovine rhodopsin at 2.6 angstroms RESOLUTION

Browse structure collections

About this viewer

MolViewer shows 3DQB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.