3DRX: BTB/POZ domain-containing protein KCTD5

X-ray crystal structure of human KCTD5 protein crystallized in high-salt buffer. Determined by X-ray diffraction at 3.11 Å resolution. Released 17 Feb 2009.

Method: X-ray diffraction
Resolution: 3.11 Å
Organism: Homo sapiens
Chains: 5
Atoms: 6,907
Mol. weight: 115.21 kDa
Released: 17 Feb 2009

Explore 3DRX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3DRX contains 44 α-helices and 39 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	45-50	6	1
β-strand	53-58	6	1
α-helix	61-63	3
α-helix	71-74	4
β-strand	84	1	1
α-helix	89	1
β-strand	90-92	3	1
α-helix	99-108	10
α-helix	119-128	10
α-helix	132-149	18
β-strand	157-163	7	2
α-helix	167-173	7
α-helix	179	1
β-strand	180-186	7	2
β-strand	201-207	7	2

Chain B: 9 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	39	1	3
β-strand	41	1	3
β-strand	45-50	6	4
β-strand	53-58	6	4
α-helix	61-63	3
α-helix	71-74	4
β-strand	84	1	4
α-helix	89	1
β-strand	90-92	3	4
α-helix	96-98	3
α-helix	100-108	9
α-helix	119-128	10
α-helix	132-149	18
β-strand	155-163	9	5
α-helix	165-167	3
α-helix	168-173	6
β-strand	180-186	7	5
β-strand	201-209	9	5

Chain C: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	45-50	6	6
β-strand	53-58	6	6
α-helix	61-63	3
α-helix	69-73	5
β-strand	84	1	6
α-helix	89	1
β-strand	90-92	3	6
α-helix	96-98	3
α-helix	99-108	10
α-helix	119-128	10
α-helix	132-149	18
β-strand	156-163	8	7
α-helix	168-173	6
β-strand	179-186	8	7
β-strand	201-208	8	7

Chain D: 10 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	45-50	6	8
β-strand	53-58	6	8
α-helix	60-63	4
α-helix	71-74	4
β-strand	84	1	8
β-strand	90-92	3	8
α-helix	96-98	3
α-helix	99-108	10
α-helix	119-128	10
α-helix	132-144	13
α-helix	146-149	4
α-helix	154-156	3
β-strand	157-163	7	9
α-helix	168-172	5
α-helix	179	1
β-strand	180-186	7	9
β-strand	201-207	7	9

Chain E: 9 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	37-38	2
β-strand	45-50	6	10
β-strand	53-58	6	10
α-helix	61-63	3
α-helix	71-74	4
α-helix	78-83	6
β-strand	84	1	10
α-helix	89	1
β-strand	90-92	3	10
α-helix	99-108	10
α-helix	119-128	10
α-helix	132-149	18
β-strand	156	1	11
β-strand	159-163	5	12
α-helix	168-173	6
β-strand	180-186	7	12
β-strand	201-206	6	12
β-strand	208	1	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
BTB/POZ domain-containing protein KCTD5	A, B, C, D, E	protein	202	Homo sapiens	Q9NXV2 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>3DRX_1 BTB/POZ domain-containing protein KCTD5 (chains A, B, C, D, E)
SALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQADPDLDSDKDETGAYLI
DRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKDKIRERDSKTSQV
PVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIGSSYNYGNEDQAEFLCVVSKELHNT
PYGTASEPSEKAKILQERGSRM

Primary citation

Pentameric assembly of potassium channel tetramerization domain-containing protein 5. Dementieva, I.S., Tereshko, V., McCrossan, Z.A. et al. J Mol Biol (2009) 387:175-191. DOI 10.1016/j.jmb.2009.01.030 · PubMed

Other PDB entries of the same protein (UniProt Q9NXV2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3DRZ 1.9 Å, X-ray crystal structure of the N-terminal BTB domain of human KCTD5 protein
8U7Z 2.97 Å, KCTD5/Cullin3/Gbeta1gamma2 Complex: Local Refinment of KCTD5(CTD)/Gbeta1gamma2
3DRY 3.3 Å, X-ray crystal structure of human KCTD5 protein crystallized in low-salt buffer
8U80 3.6 Å, KCTD5/Cullin3/Gbeta1gamma2 Complex: Local Refinment of KCTD5(BTB)/Cullin3(NTD)
8U81 3.82 Å, KCTD5/Cullin3/Gbeta1gamma2 Complex: State A From Composite RELION Multi-body Refinement…
8U82 3.84 Å, KCTD5/Cullin3/Gbeta1gamma2 Complex: State B From Composite RELION Multi-body Refinement…
8U84 3.88 Å, KCTD5/Cullin3/Gbeta1gamma2 Complex: State D From Composite RELION Multi-body Refinement…
8U83 3.98 Å, KCTD5/Cullin3/Gbeta1gamma2 Complex: State C From Composite RELION Multi-body Refinement…

Browse structure collections

About this viewer

MolViewer shows 3DRX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.