3DRZ: N-terminal BTB domain of human KCTD5 protein

X-ray crystal structure of the N-terminal BTB domain of human KCTD5 protein. Determined by X-ray diffraction at 1.9 Å resolution. Released 17 Feb 2009.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 5
Atoms: 4,454
Mol. weight: 61.6 kDa
Released: 17 Feb 2009

Explore 3DRZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3DRZ contains 33 α-helices and 20 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	45-50	6	1
β-strand	53-58	6	1
α-helix	59-62	4
α-helix	69-74	6
α-helix	78-83	6
β-strand	84	1	1
α-helix	89	1
β-strand	90-92	3	1
α-helix	96-108	13
α-helix	119-129	11
α-helix	132-144	13

Chain B: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	45-50	6	2
β-strand	53-58	6	2
α-helix	59-62	4
α-helix	70-74	5
α-helix	78-80	3
β-strand	84	1	2
α-helix	89	1
β-strand	90-92	3	2
α-helix	96-108	13
α-helix	119-129	11
α-helix	132-144	13

Chain C: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	45-50	6	3
β-strand	53-58	6	3
α-helix	59-62	4
α-helix	69-73	5
β-strand	84	1	3
α-helix	89	1
β-strand	90-92	3	3
α-helix	96-108	13
α-helix	119-128	10
α-helix	132-143	12

Chain D: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	45-50	6	4
β-strand	53-58	6	4
α-helix	59-62	4
α-helix	71-73	3
β-strand	84	1	4
α-helix	89	1
β-strand	90-92	3	4
α-helix	96-98	3
α-helix	99-108	10
α-helix	119-128	10
α-helix	132-143	12

Chain E: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	45-50	6	5
β-strand	53-58	6	5
α-helix	59-62	4
α-helix	69-73	5
β-strand	84	1	5
α-helix	89	1
β-strand	90-92	3	5
α-helix	96-108	13
α-helix	119-129	11
α-helix	132-144	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
BTB/POZ domain-containing protein KCTD5	A, B, C, D, E	protein	107	Homo sapiens	Q9NXV2 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>3DRZ_1 BTB/POZ domain-containing protein KCTD5 (chains A, B, C, D, E)
SGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQADPDLDSDKDETGAYLIDRDPTY
FGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKDKIRER

Primary citation

Pentameric assembly of potassium channel tetramerization domain-containing protein 5. Dementieva, I.S., Tereshko, V., McCrossan, Z.A. et al. J Mol Biol (2009) 387:175-191. DOI 10.1016/j.jmb.2009.01.030 · PubMed

Other PDB entries of the same protein (UniProt Q9NXV2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8U7Z 2.97 Å, KCTD5/Cullin3/Gbeta1gamma2 Complex: Local Refinment of KCTD5(CTD)/Gbeta1gamma2
3DRX 3.11 Å, X-ray crystal structure of human KCTD5 protein crystallized in high-salt buffer
3DRY 3.3 Å, X-ray crystal structure of human KCTD5 protein crystallized in low-salt buffer
8U80 3.6 Å, KCTD5/Cullin3/Gbeta1gamma2 Complex: Local Refinment of KCTD5(BTB)/Cullin3(NTD)
8U81 3.82 Å, KCTD5/Cullin3/Gbeta1gamma2 Complex: State A From Composite RELION Multi-body Refinement…
8U82 3.84 Å, KCTD5/Cullin3/Gbeta1gamma2 Complex: State B From Composite RELION Multi-body Refinement…
8U84 3.88 Å, KCTD5/Cullin3/Gbeta1gamma2 Complex: State D From Composite RELION Multi-body Refinement…
8U83 3.98 Å, KCTD5/Cullin3/Gbeta1gamma2 Complex: State C From Composite RELION Multi-body Refinement…

Browse structure collections

About this viewer

MolViewer shows 3DRZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.