3DVU: V-bcl-2

Crystal structure of the complex of murine gamma-herpesvirus 68 Bcl-2 homolog M11 and the Beclin 1 BH3 domain. Determined by X-ray diffraction at 2.5 Å resolution. Released 7 Oct 2008.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Murid herpesvirus 4
Chains: 4
Atoms: 2,578
Mol. weight: 39 kDa
Released: 7 Oct 2008

Explore 3DVU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3DVU contains 19 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	7-21	15
α-helix	32-55	24
α-helix	61-64	4
α-helix	67-78	12
α-helix	85-97	13
α-helix	98-102	5
α-helix	104	1
α-helix	110-125	16
α-helix	128-130	3

Chain B: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	7-21	15
α-helix	35-56	22
α-helix	61-64	4
α-helix	67-78	12
α-helix	85-97	13
α-helix	98-102	5
α-helix	104	1
α-helix	110-125	16

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	107-123	17

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	108-124	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
V-bcl-2	A, B	protein	143	Murid herpesvirus 4	P89884 (AlphaFold model)
Beclin-1	C, D	protein	26		Q14457 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3DVU_1 V-bcl-2 (chains A, B)
MASHKKSGTYWATLITAFLKTVSKVEELDCVDSAVLVDVSKIITLTQEFRRHYDSVYRAD
YGPALKNWKRDLSKLFTSLFVDVINSGRIVGFFDVGRYVCEEVLCPGSWTEDHELLNDCM
THFFIENNLMNHFPLEDHHHHHH

Sequence of entity 2 (C, D), FASTA

>3DVU_2 Beclin-1 (chains C, D)
DGGTMENLSRRLKVTGDLFDIMSGQT

Primary citation

Molecular basis of the regulation of Beclin 1-dependent autophagy by the gamma-herpesvirus 68 Bcl-2 homolog M11. Sinha, S., Colbert, C.L., Becker, N. et al. Autophagy (2008) 4:989-997. DOI 10.4161/auto.6803 · PubMed

Other PDB entries of the same protein (UniProt P89884 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4MI8 2.1 Å, Crystal structure of the complex of murine gamma-herpesvirus 68 Bcl-2 homolog M11 and a…
3BL2 2.3 Å, Crystal Structure of M11, the BCL-2 Homolog of Murine Gamma-herpesvirus 68, Complexed…
2ABO NMR structure of gamma herpesvirus 68 a viral Bcl-2 homolog

Browse structure collections

About this viewer

MolViewer shows 3DVU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.