3DXB: UHM domain of Puf60 fused to thioredoxin

Structure of the UHM domain of Puf60 fused to thioredoxin. Determined by X-ray diffraction at 2.2 Å resolution. Released 28 Oct 2008.

Method: X-ray diffraction
Resolution: 2.2 Å
Organisms: Escherichia coli O157:H7, Homo sapiens
Chains: 8
Atoms: 14,337
Mol. weight: 197.58 kDa
Released: 28 Oct 2008

Explore 3DXB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3DXB contains 76 α-helices and 104 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	349-350	2	1
α-helix	356	1
α-helix	357-361	5
β-strand	367-372	6	1
α-helix	377-392	16
β-strand	398-403	6	1
α-helix	411-414	4
β-strand	419	1	2
β-strand	421-426	6	1
β-strand	429-435	7	1
α-helix	440-450	11
β-strand	457	1	3
β-strand	460-464	5	4
α-helix	469-471	3
α-helix	476-484	9
β-strand	490-499	10	4
α-helix	506-507	2
β-strand	508-516	9	4
α-helix	519-529	11
β-strand	533	1	5
β-strand	538	1	5
β-strand	540-543	4	4
α-helix	546-550	5

Chain B: 11 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	348	1
β-strand	349-350	2	6
α-helix	351	1
α-helix	356	1
α-helix	357-361	5
β-strand	366-372	7	6
α-helix	377-392	16
β-strand	397-403	7	6
α-helix	411-414	4
β-strand	419	1	3
β-strand	421-426	6	6
β-strand	429-435	7	6
α-helix	440-450	11
β-strand	457	1	7
β-strand	460-464	5	8
α-helix	469-471	3
α-helix	476-484	9
β-strand	490-499	10	8
β-strand	508-516	9	8
α-helix	519-529	11
β-strand	533-534	2	9
β-strand	537-538	2	9
β-strand	540-543	4	8
α-helix	546-550	5

Chains C and G: 9 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	349-350	2	10
α-helix	356	1
α-helix	357-361	5
β-strand	366-372	7	10
α-helix	377-392	16
β-strand	397-403	7	10
α-helix	411-414	4
β-strand	419	1	7
β-strand	421-426	6	10
β-strand	429-435	7	10
α-helix	440-451	12
β-strand	457	1	11
β-strand	460-464	5	12
α-helix	469-471	3
α-helix	476-484	9
β-strand	490-499	10	12
β-strand	508-516	9	12
α-helix	519-529	11
β-strand	533-534	2	13
β-strand	537-538	2	13
β-strand	540-543	4	12
α-helix	546-550	5

Chain D: 9 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	349-350	2	14
α-helix	356	1
α-helix	357-361	5
β-strand	367-372	6	14
α-helix	377-392	16
β-strand	398-403	6	14
α-helix	411-414	4
β-strand	419	1	15
β-strand	421-426	6	14
β-strand	429-435	7	14
α-helix	440-450	11
β-strand	457	1	16
β-strand	460-464	5	17
α-helix	476-484	9
β-strand	490-499	10	17
α-helix	506-507	2
β-strand	508-516	9	17
α-helix	519-529	11
β-strand	533	1	18
β-strand	538	1	18
β-strand	540-543	4	17
α-helix	546-550	5

Chain E: 8 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	349-350	2	19
α-helix	356	1
α-helix	357-361	5
β-strand	366-372	7	19
α-helix	377-392	16
β-strand	397-403	7	19
α-helix	411-414	4
β-strand	419	1	20
β-strand	421-426	6	19
β-strand	429-435	7	19
α-helix	440-451	12
β-strand	457	1	21
β-strand	460-464	5	22
α-helix	476-484	9
β-strand	490-499	10	22
β-strand	508-516	9	22
α-helix	519-529	11
β-strand	533-534	2	23
β-strand	537-538	2	23
β-strand	540-543	4	22
α-helix	546-550	5

Chain F: 10 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	349-350	2	24
α-helix	356	1
α-helix	357-361	5
β-strand	366-372	7	24
α-helix	377-392	16
β-strand	397-403	7	24
α-helix	411-414	4
β-strand	419	1	16
β-strand	421-426	6	24
β-strand	429-435	7	24
α-helix	440-450	11
β-strand	457	1	20
β-strand	460-464	5	25
α-helix	469-471	3
α-helix	476-484	9
β-strand	490-499	10	25
α-helix	506-507	2
β-strand	508-516	9	25
α-helix	519-529	11
β-strand	533-534	2	26
β-strand	537-538	2	26
β-strand	540-543	4	25
α-helix	546-550	5

Chain H: 10 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	349-350	2	30
α-helix	356	1
α-helix	357-361	5
β-strand	366-372	7	30
α-helix	377-392	16
β-strand	397-403	7	30
α-helix	411-414	4
β-strand	419	1	11
β-strand	421-426	6	30
β-strand	429-435	7	30
α-helix	440-452	13
β-strand	457	1	2
β-strand	460-464	5	31
α-helix	469-471	3
α-helix	476-484	9
β-strand	490-500	11	31
α-helix	506	1
β-strand	507-516	10	31
α-helix	519-529	11
β-strand	533-534	2	32
β-strand	537-538	2	32
β-strand	540-544	5	31
α-helix	546-550	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
thioredoxin N-terminally fused to Puf60(UHM)	A, B, C, D, E, F, G, H	protein	222	Escherichia coli O157:H7, Homo sapiens	P0AA27 (AlphaFold model), Q9UHX1 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>3DXB_1 thioredoxin N-terminally fused to Puf60(UHM) (chains A, B, C, D, E, F, G, H)
MKHHHHHHPMSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQ
GKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGS
AMESTVMVLRNMVDPKDIDDDLEGEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFV
EFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA

Primary citation

Dimerization and Protein Binding Specificity of the U2AF Homology Motif of the Splicing Factor Puf60. Corsini, L., Hothorn, M., Stier, G. et al. J Biol Chem (2009) 284:630-639. DOI 10.1074/jbc.M805395200 · PubMed

Other PDB entries of the same protein (UniProt P0AA27 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5E4W 2.8 Å, Crystal structure of cpSRP43 chromodomains 2 and 3 in complex with the Alb3 tail
5IKN 4.8 Å, Crystal Structure of the T7 Replisome in the Absence of DNA

Browse structure collections

About this viewer

MolViewer shows 3DXB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.