The Crystal Structure of the Anti-Viral APOBEC3G Catalytic Domain. Determined by X-ray diffraction at 2.3 Å resolution. Released 7 Oct 2008.
Explore 3E1U in 3D Show helices and sheets RCSB PDB PDBe
3E1U contains 9 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 199-206 | 8 | |
| β-strand | 219-226 | 8 | 1 |
| β-strand | 235-243 | 9 | 1 |
| β-strand | 245 | 1 | 2 |
| β-strand | 256 | 1 | 2 |
| α-helix | 258-265 | 8 | |
| β-strand | 277-283 | 7 | 1 |
| α-helix | 286-288 | 3 | |
| α-helix | 289-302 | 14 | |
| β-strand | 305-311 | 7 | 1 |
| α-helix | 321-330 | 10 | |
| β-strand | 334-337 | 4 | 1 |
| α-helix | 340-350 | 11 | |
| α-helix | 356-358 | 3 | |
| α-helix | 360-361 | 2 | |
| α-helix | 364-379 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA dC->dU-editing enzyme APOBEC-3G | A | protein | 189 | Homo sapiens | Q9HC16 (AlphaFold model) |
>3E1U_1 DNA dC->dU-editing enzyme APOBEC-3G (chains A) GPLGSMDPPTFTFNFNNEPWVRGRHETYLCYEVERMHNDTWVLLNQRRGFLCNQAPHKHG FLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFT ARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGCPFQPWDGLDEHSQDL SGRLRAILQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Crystal structure of the anti-viral APOBEC3G catalytic domain and functional implications. Holden, L.G., Prochnow, C., Chang, Y.P. et al. Nature (2008) 456:121-124. DOI 10.1038/nature07357 · PubMed
Other PDB entries of the same protein (UniProt Q9HC16 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3E1U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.