Crystal structure of the human SENP7 catalytic domain. Determined by X-ray diffraction at 2.4 Å resolution. Released 16 Sept 2008.
Explore 3EAY in 3D Show helices and sheets RCSB PDB PDBe
3EAY contains 14 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 681-685 | 5 | 1 |
| α-helix | 687 | 1 | |
| β-strand | 694-697 | 4 | 1 |
| α-helix | 698-702 | 5 | |
| α-helix | 712-725 | 14 | |
| α-helix | 729-733 | 5 | |
| β-strand | 735-737 | 3 | 2 |
| α-helix | 741-746 | 6 | |
| α-helix | 762-767 | 6 | |
| α-helix | 771-774 | 4 | |
| α-helix | 779-781 | 3 | |
| β-strand | 784-791 | 8 | 2 |
| β-strand | 794-801 | 8 | 2 |
| β-strand | 809 | 1 | 3 |
| β-strand | 865 | 1 | 3 |
| β-strand | 868-872 | 5 | 2 |
| α-helix | 880-899 | 20 | |
| β-strand | 912-913 | 2 | 2 |
| β-strand | 916 | 1 | 4 |
| α-helix | 918-920 | 3 | |
| α-helix | 926-939 | 14 | |
| α-helix | 946 | 1 | |
| β-strand | 950 | 1 | 4 |
| α-helix | 957-961 | 5 | |
| α-helix | 963-980 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sentrin-specific protease 7 | A | protein | 323 | Homo sapiens | Q9BQF6 (AlphaFold model) |
>3EAY_1 Sentrin-specific protease 7 (chains A) ITSNPDEEWREVRHTGLVQKLIVYPPPPTKGGLGVTNEDLECLEEGEFLNDVIIDFYLKY LILEKASDELVERSHIFSSFFYKCLTRKENNLTEDNPNLSMAQRRHKRVRTWTRHINIFN KDYIFVPVNESSHWYLAVICFPWLEEAVYEDFPQTVSQQSQAQQSQNDNKTIDNDLRTTS TLSLSAEDSQSTESNMSVPKKMCKRPCILILDSLKAASVQNTVQNLREYLEVEWEVKLKT HRQFSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFKDPIVNFELPIHLEKWFPRHVIK TKREDIRELILKLHLQQQKGSSS
Structure of the Human SENP7 Catalytic Domain and Poly-SUMO Deconjugation Activities for SENP6 and SENP7. Lima, C.D., Reverter, D. J Biol Chem (2008) 283:32045-32055. DOI 10.1074/jbc.M805655200 · PubMed
Other PDB entries of the same protein (UniProt Q9BQF6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3EAY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.