7R2E: Human Senp7 with SUMO2

Structure of human Senp7 with SUMO2. Determined by X-ray diffraction at 1.74 Å resolution. Released 7 Dec 2022.

Method: X-ray diffraction
Resolution: 1.74 Å
Organism: Homo sapiens
Chains: 4
Atoms: 5,639
Mol. weight: 98.04 kDa
Ligands: AYE
Released: 7 Dec 2022

Explore 7R2E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7R2E contains 37 α-helices and 36 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	681-685	5	1
α-helix	687	1
β-strand	694-697	4	1
α-helix	698-701	4
α-helix	702-704	3
α-helix	708-710	3
β-strand	711	1	2
α-helix	712-721	10
α-helix	722-726	5
α-helix	729-734	6
β-strand	735-737	3	3
α-helix	742-746	5
α-helix	762-769	8
α-helix	771-774	4
α-helix	779-781	3
β-strand	784-790	7	3
β-strand	795-801	7	3
β-strand	809-810	2	4
β-strand	864-865	2	4
β-strand	868-872	5	3
α-helix	880-899	20
β-strand	911-913	3	3
β-strand	916	1	5
α-helix	926-939	14
α-helix	946	1
β-strand	950	1	5
α-helix	957-961	5
α-helix	963-980	18

Chain B: 17 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	681-685	5	6
α-helix	687	1
α-helix	693	1
β-strand	694-697	4	6
α-helix	698-701	4
α-helix	702-704	3
α-helix	708-710	3
β-strand	711	1	7
α-helix	712-721	10
α-helix	722-726	5
α-helix	729-734	6
β-strand	735-737	3	8
α-helix	742-746	5
α-helix	762-769	8
α-helix	771-774	4
α-helix	779-781	3
β-strand	784-790	7	8
β-strand	795-801	7	8
β-strand	809-810	2	9
β-strand	864-865	2	9
β-strand	868-872	5	8
α-helix	880-899	20
β-strand	911-913	3	8
β-strand	916	1	10
α-helix	926-939	14
α-helix	946	1
β-strand	950	1	10
α-helix	957-961	5
α-helix	963-979	17

Chain C: 1 helix, 6 β-strands

Element	Residues	Length	Sheet
β-strand	18-23	6	11
β-strand	29-34	6	11
α-helix	41-50	10
β-strand	58-62	5	11
β-strand	65-66	2	11
β-strand	82-88	7	11
β-strand	91	1	7

Chain D: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	18-23	6	12
β-strand	29-34	6	12
α-helix	41-51	11
α-helix	55-57	3
β-strand	58-62	5	12
β-strand	65-66	2	12
α-helix	73-76	4
β-strand	82-88	7	12
β-strand	91	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sentrin-specific protease 7	A, B	protein	345	Homo sapiens	Q9BQF6 (AlphaFold model)
Small ubiquitin-related modifier 3	C, D	protein	76	Homo sapiens	P55854 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7R2E_1 Sentrin-specific protease 7 (chains A, B)
MGSSHHHHHHSSGLVPRGSHMASTSNPDEEWREVRHTGLVQKLIVYPPPPTKGGLGVTNE
DLECLEEGEFLNDVIIDFYLKYLILEKASDELVERSHIFSSFFYKCLTRKENNLTEDNPN
LSMAQRRHKRVRTWTRHINIFNKDYIFVPVNESSHWYLAVICFPWLEEAVYEDFPQTVSQ
QSQAQQSQNDNKTIDNDLRTTSTLSLSAEDSQSTESNMSVPKKMCKRPCILILDSLKAAS
VQNTVQNLREYLEVEWEVKLKTHRQFSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFK
DPIVNFELPIHLEKWFPRHVIKTKREDIRELILKLHLQQQKGSSS

Sequence of entity 2 (C, D), FASTA

>7R2E_2 Small ubiquitin-related modifier 3 (chains C, D)
HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQL
EMEDEDTIDVFQQQTG

Ligands and cofactors

ID	Name	Formula	Copies
AYE	prop-2-en-1-amine	C3 H7 N	2

Primary citation

Structural Basis for the SUMO2 Isoform Specificity of SENP7. Li, Y., De Bolos, A., Amador, V. et al. J Mol Biol (2022) 434:167875-167875. DOI 10.1016/j.jmb.2022.167875 · PubMed

Other PDB entries of the same protein (UniProt Q9BQF6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3EAY 2.4 Å, Crystal structure of the human SENP7 catalytic domain

Browse structure collections

About this viewer

MolViewer shows 7R2E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.