3EB5: CIAP2 RING domain

Structure of the cIAP2 RING domain. Determined by X-ray diffraction at 2.0 Å resolution. Released 9 Sept 2008.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 551
Mol. weight: 8.39 kDa
Ligands: ZN
Released: 9 Sept 2008

Explore 3EB5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3EB5 contains 5 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	544-555	12
β-strand	556	1	1
β-strand	564	1	1
α-helix	565	1
β-strand	567-570	4	2
β-strand	575-577	3	2
α-helix	582-584	3
β-strand	587	1	3
α-helix	593	1
β-strand	594	1	3
α-helix	595	1
β-strand	597-600	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Baculoviral IAP repeat-containing protein 3	A	protein	74	Homo sapiens	Q13489 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3EB5_1 Baculoviral IAP repeat-containing protein 3 (chains A)
LGSGTTEDVSDLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPI
CRSTIKGTVRTFLS

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Water and common crystallization additives (NA) are not listed.

Primary citation

Structures of the cIAP2 RING domain reveal conformational changes associated with ubiquitin-conjugating enzyme (E2) recruitment. Mace, P.D., Linke, K., Feltham, R. et al. J Biol Chem (2008) 283:31633-31640. DOI 10.1074/jbc.M804753200 · PubMed

Other PDB entries of the same protein (UniProt Q13489 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2UVL 1.91 Å, Human BIR3 domain of Baculoviral Inhibitor of Apoptosis Repeat- Containing 3 (BIRC3)
3M0A 2.61 Å, Crystal structure of TRAF2:cIAP2 complex
3M0D 2.8 Å, Crystal structure of the TRAF1:TRAF2:cIAP2 complex
7NK0 3.3 Å, Structure of the BIR1 domain of cIAP2
3EB6 3.4 Å, Structure of the cIAP2 RING domain bound to UbcH5b

Browse structure collections

About this viewer

MolViewer shows 3EB5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.