3EB6: CIAP2 RING domain

Structure of the cIAP2 RING domain bound to UbcH5b. Determined by X-ray diffraction at 3.4 Å resolution. Released 9 Sept 2008.

Method: X-ray diffraction
Resolution: 3.4 Å
Organisms: Homo sapiens, Xenopus laevis
Chains: 2
Atoms: 1,693
Mol. weight: 25.27 kDa
Ligands: ZN
Released: 9 Sept 2008

Explore 3EB6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3EB6 contains 10 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	549-555	7
β-strand	556	1	1
β-strand	564	1	1
α-helix	565	1
β-strand	567-570	4	2
β-strand	575-577	3	2
α-helix	582-584	3
β-strand	587	1	3
α-helix	593	1
β-strand	594	1	3
α-helix	595	1
β-strand	597-600	4	2

Chain B: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	2-15	14
β-strand	21-25	5	4
β-strand	32-37	6	4
β-strand	50-55	6	4
β-strand	66-69	4	4
β-strand	75	1	5
β-strand	78	1	5
β-strand	83	1	4
β-strand	84	1	5
α-helix	99-111	13
α-helix	121-129	9
α-helix	131-141	11
α-helix	142-146	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Baculoviral IAP repeat-containing protein 3	A	protein	74	Homo sapiens	Q13489 (AlphaFold model)
Ubiquitin-conjugating enzyme E2 D2	B	protein	149	Xenopus laevis	P62840 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3EB6_1 Baculoviral IAP repeat-containing protein 3 (chains A)
LGSGTTEDVSDLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPI
CRSTIKGTVRTFLS

Sequence of entity 2 (B), FASTA

>3EB6_2 Ubiquitin-conjugating enzyme E2 D2 (chains B)
GSMALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPT
DYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDP
LVPEIARIYKTDREKYNRIAREWTQKYAM

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Structures of the cIAP2 RING Domain Reveal Conformational Changes Associated with Ubiquitin-conjugating Enzyme (E2) Recruitment. Mace, P.D., Linke, K., Feltham, R. et al. J Biol Chem (2008) 283:31633-31640. DOI 10.1074/jbc.M804753200 · PubMed

Other PDB entries of the same protein (UniProt Q13489 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2UVL 1.91 Å, Human BIR3 domain of Baculoviral Inhibitor of Apoptosis Repeat- Containing 3 (BIRC3)
3EB5 2.0 Å, Structure of the cIAP2 RING domain
3M0A 2.61 Å, Crystal structure of TRAF2:cIAP2 complex
3M0D 2.8 Å, Crystal structure of the TRAF1:TRAF2:cIAP2 complex
7NK0 3.3 Å, Structure of the BIR1 domain of cIAP2

Browse structure collections

About this viewer

MolViewer shows 3EB6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.