3EB8: VirA

VirA. Determined by X-ray diffraction at 2.4 Å resolution. Released 30 Sept 2008.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Shigella flexneri
Chains: 2
Atoms: 5,371
Mol. weight: 79.75 kDa
Released: 30 Sept 2008

Explore 3EB8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3EB8 contains 34 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	54-63	10
β-strand	66-67	2	1
α-helix	73-74	2
β-strand	77-83	7	1
β-strand	86-93	8	1
β-strand	96-103	8	1
β-strand	108-111	4	1
α-helix	112-113	2
α-helix	114-123	10
β-strand	128-129	2	2
β-strand	136-139	4	2
α-helix	152-160	9
β-strand	163-165	3	2
β-strand	171	1	3
α-helix	172-174	3
α-helix	182-191	10
α-helix	193-195	3
β-strand	199-202	4	2
β-strand	205-206	2	2
α-helix	207-208	2
α-helix	209-218	10
α-helix	231-235	5
α-helix	236-246	11
α-helix	252-263	12
α-helix	268-276	9
β-strand	286	1	3
α-helix	287-307	21
β-strand	316-325	10	2
β-strand	342-354	13	2
β-strand	357-369	13	2
α-helix	377-383	7
α-helix	386-388	3
β-strand	390-398	9	2

Chain B: 17 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	57-60	4
β-strand	66-67	2	4
α-helix	73-74	2
β-strand	77-83	7	4
β-strand	86-93	8	4
β-strand	96-103	8	4
β-strand	108-111	4	4
α-helix	112-113	2
α-helix	114-123	10
β-strand	128-129	2	5
β-strand	136-139	4	5
α-helix	152-160	9
β-strand	163-165	3	5
β-strand	171	1	6
α-helix	172-174	3
α-helix	182-191	10
α-helix	193-195	3
β-strand	199-202	4	5
β-strand	205-206	2	5
α-helix	207-208	2
α-helix	209-218	10
α-helix	229-235	7
α-helix	236-246	11
α-helix	252-263	12
α-helix	268-276	9
β-strand	286	1	6
α-helix	287-307	21
β-strand	316-325	10	5
β-strand	342-354	13	5
β-strand	357-369	13	5
α-helix	377-383	7
α-helix	386-388	3
β-strand	390-398	9	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cysteine protease-like virA	A, B	protein	358	Shigella flexneri	Q7BU69 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3EB8_1 Cysteine protease-like virA (chains A, B)
GSIYSPHETLAEKHSEKKLMDSFSPSLSQDKMDGEFAHANIDGISIRLCLNKGICSVFYL
DGDKIQSTQLSSKEYNNLLSSLPPKQFNLGKVHTITAPVSGNFKTHKPAPEVIETAINCC
TSIIPNDDYFHVKDTDFNSVWHDIYRDIRASDSNSTKIYFNNIEIPLKLIADLINELGIN
EFIDSKKELQMLSYNQVNKIINSNFPQQDLCFQTEKLLFTSLFQDPAFISALTSAFWQSL
HITSSSVEHIYAQIMSENIENRLNFMPEQRVINNCGHIIKINAVVPKNDTAISASGGRAY
EVSSSILPSHITCNGVGINKIETSYLVHAGTLPSSEGLRNAIPPESRQVSFAIISPDV

Primary citation

Structural and functional studies indicate that Shigella VirA is not a protease and does not directly destabilize microtubules. Germane, K.L., Ohi, R., Goldberg, M.B. et al. Biochemistry (2008) 47:10241-10243. DOI 10.1021/bi801533k · PubMed

Other PDB entries of the same protein (UniProt Q7BU69 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3EE1 3.01 Å, Novel fold of VirA, a type III secretion system effector protein from Shigella flexneri
4FMB 3.2 Å, VirA-Rab1 complex structure

Browse structure collections

About this viewer

MolViewer shows 3EB8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.