3EIR: Putative ATP/GTP binding protein

Crystal structure of CHBP, a Cif Homologue from Burkholderia pseudomallei. Determined by X-ray diffraction at 2.1 Å resolution. Released 3 Feb 2009.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Burkholderia pseudomallei
Chains: 2
Atoms: 4,121
Mol. weight: 62.62 kDa
Released: 3 Feb 2009

Explore 3EIR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3EIR contains 32 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	81-95	15
α-helix	99-105	7
α-helix	114-116	3
α-helix	119-132	14
α-helix	136-143	8
α-helix	156-168	13
β-strand	182	1	1
α-helix	187-191	5
β-strand	199-206	8	1
β-strand	211-217	7	1
β-strand	227	1	2
β-strand	228-230	3	1
β-strand	233	1	3
α-helix	240-241	2
β-strand	242	1	3
α-helix	244-251	8
β-strand	256	1	2
α-helix	258-264	7
α-helix	267-271	5
α-helix	274-285	12
α-helix	291-293	3
α-helix	296-298	3
β-strand	305-312	8	1
α-helix	314-325	12

Chain B: 17 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	80-95	16
α-helix	99-105	7
α-helix	114-116	3
α-helix	119-132	14
α-helix	136-142	7
α-helix	151-152	2
α-helix	156-168	13
β-strand	182	1	4
α-helix	187-193	7
β-strand	199-206	8	4
β-strand	211-217	7	4
α-helix	218-220	3
β-strand	227	1	5
β-strand	228-230	3	4
β-strand	233	1	6
α-helix	240-241	2
β-strand	242	1	6
α-helix	244-251	8
β-strand	256	1	5
α-helix	258-265	8
α-helix	267-271	5
α-helix	274-285	12
α-helix	291-293	3
α-helix	296-298	3
β-strand	305-312	8	4
α-helix	314-325	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Putative ATP/GTP binding protein	A, B	protein	281	Burkholderia pseudomallei	Q63KH5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3EIR_1 Putative ATP/GTP binding protein (chains A, B)
GLPARSSSISNTNRTGENPMITPIISSNLGLKHRVTLRKATLASLMQSLSGESSNRVMWN
DRYDTLLIARDPREIKNAIEKSVTDFGGLENYKELTGGADPFALMTPVCGLSANNIFKLM
TEKDVPIDPTSIEYLENTSFAEHVNTLDSHKNYVVIVNDGRLGHKFLIDLPALTQGPRTA
YIIQSDLGGGALPAVRVEDWISRRGSDPVSLDELNQLLSKDFSKMPDDVQTRLLASILQI
DKDPHKVDIKKLHLDGKLRFASHEYDFRQFQRNAQYVAGLG

Primary citation

A bacterial type III effector family uses the papain-like hydrolytic activity to arrest the host cell cycle. Yao, Q., Cui, J., Zhu, Y. et al. Proc Natl Acad Sci U S A (2009) 106:3716-3721. DOI 10.1073/pnas.0900212106 · PubMed

Other PDB entries of the same protein (UniProt Q63KH5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3GQM 2.1 Å, Crystal structure of Cell Inhibiting Factor (Cif) from Burkholderia pseudomallei (CifBp)
4HCP 2.52 Å, crystal structure of Burkholderia pseudomallei effector protein chbp in complex with nedd8
3EIT 2.56 Å, the 2.6 angstrom crystal structure of CHBP, the Cif Homologue from Burkholderia…
4HCN 2.6 Å, Crystal structure of Burkholderia pseudomallei effector protein CHBP in complex with…

Browse structure collections

About this viewer

MolViewer shows 3EIR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.