Crystal structure of IBV X-domain at pH 8.5. Determined by X-ray diffraction at 1.6 Å resolution. Released 30 Sept 2008.
Explore 3EJF in 3D Show helices and sheets RCSB PDB PDBe
3EJF contains 8 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 11-16 | 6 | 1 |
| α-helix | 19-30 | 12 | |
| β-strand | 33-38 | 6 | 1 |
| α-helix | 48-57 | 10 | |
| α-helix | 59-72 | 14 | |
| β-strand | 77-80 | 4 | 1 |
| β-strand | 87-93 | 7 | 1 |
| α-helix | 96-97 | 2 | |
| α-helix | 103-112 | 10 | |
| β-strand | 121-125 | 5 | 1 |
| α-helix | 126-127 | 2 | |
| α-helix | 136-147 | 12 | |
| β-strand | 153-158 | 6 | 1 |
| α-helix | 161-169 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Non-structural protein 3 | A | protein | 176 | Avian infectious bronchitis virus (strain Beaudette) | P0C6Y1 (AlphaFold model) |
>3EJF_1 Non-structural protein 3 (chains A) GAMAPATCEKPKFLEYKTCVGDLTVVIAKALDEFKEFCIVNAANEHMTHGSGVAKAIADF CGLDFVEYCEDYVKKHGPQQRLVTPSFVKGIQCVNNVVGPRHGDNNLHEKLVAAYKNVLV DGVVNYVVPVLSLGIFGVDFKMSIDAMREAFEGCTIRVLLFSLSQEHIDYFDVTCK
Crystal structures of the X-domains of a Group-1 and a Group-3 coronavirus reveal that ADP-ribose-binding may not be a conserved property. Piotrowski, Y., Hansen, G., Boomaars-van der Zanden, A.L. et al. Protein Sci (2009) 18:6-16. DOI 10.1002/pro.15 · PubMed
Other PDB entries of the same protein (UniProt P0C6Y1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3EJF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.