3EKS: Monomeric Actin

Crystal Structure of Monomeric Actin bound to Cytochalasin D. Determined by X-ray diffraction at 1.8 Å resolution. Released 7 Oct 2008.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Drosophila melanogaster
Chains: 1
Atoms: 3,241
Mol. weight: 42.92 kDa
Ligands: CY9, CA, ATP
Released: 7 Oct 2008

Explore 3EKS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3EKS contains 24 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	6-7	2
β-strand	8-11	4	1
β-strand	16-21	6	1
β-strand	22	1	2
β-strand	24	1	2
β-strand	29-32	4	1
β-strand	35-38	4	3
α-helix	41-42	2
β-strand	53-54	2	3
α-helix	56-59	4
α-helix	62-64	3
β-strand	65-68	4	3
β-strand	71-72	2	4
β-strand	75-76	2	4
α-helix	79-88	10
α-helix	89-94	6
α-helix	98-100	3
β-strand	103-107	5	1
α-helix	113-125	13
β-strand	131-136	6	1
α-helix	137-144	8
β-strand	150-155	6	5
β-strand	160-166	7	5
β-strand	169-170	2	5
α-helix	172-174	3
β-strand	176-178	3	5
α-helix	182-195	14
α-helix	203-216	14
α-helix	223-232	10
β-strand	238-241	4	6
β-strand	247-250	4	6
α-helix	253-259	7
α-helix	264-267	4
α-helix	272-273	2
α-helix	274-282	9
α-helix	287-294	8
β-strand	297-300	4	5
α-helix	302-305	4
α-helix	309-320	12
β-strand	329-330	2	5
α-helix	338-347	10
α-helix	353-355	3
β-strand	357-358	2	1
α-helix	359-365	7
α-helix	369-373	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Actin-5C	A	protein	375	Drosophila melanogaster	P10987 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3EKS_1 Actin-5C (chains A)
CDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTEEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELKDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF

Ligands and cofactors

ID	Name	Formula	Copies
CY9	(3S,3aR,4S,6S,6aR,7E,10S,12R,13E,15R,15aR)-3-benzyl-6,12-dihydroxy-4,10,12-trim…	C30 H37 N O6	1
CA	Calcium ion	Ca	2
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	1

Primary citation

Crystal structures of monomeric actin bound to cytochalasin D. Nair, U.B., Joel, P.B., Wan, Q. et al. J Mol Biol (2008) 384:848-864. DOI 10.1016/j.jmb.2008.09.082 · PubMed

Other PDB entries of the same protein (UniProt P10987 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HF3 1.8 Å, Crystal structure of monomeric Actin in the ADP bound state
2HF4 1.8 Å, Crystal structure of Monomeric Actin in its ATP-bound state
3MN6 2.0 Å, Structures of actin-bound WH2 domains of Spire and the implication for filament nucleation
3MN7 2.0 Å, Structures of actin-bound WH2 domains of Spire and the implication for filament nucleation
3MN9 2.0 Å, Structures of actin-bound WH2 domains of Spire and the implication for filament nucleation
3EKU 2.5 Å, Crystal Structure of Monomeric Actin bound to Cytochalasin D
3EL2 2.5 Å, Crystal Structure of Monomeric Actin Bound to Ca-ATP
4M63 2.75 Å, Crystal Structure of a Filament-Like Actin Trimer Bound to the Bacterial Effector VopL
3MMV 2.8 Å, Structures of actin-bound WH2 domains of Spire and the implication for filament nucleation
4JHD 2.91 Å, Crystal Structure of an Actin Dimer in Complex with the Actin Nucleator Cordon-Bleu
4RWT 2.98 Å, Structure of actin-Lmod complex
5WFN 3.0 Å, Revised model of leiomodin 2-mediated actin regulation (alternate refinement of PDB 4RWT)

Browse structure collections

About this viewer

MolViewer shows 3EKS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.