3ERT: Protein

Human estrogen receptor alpha ligand-binding domain in complex with 4-hydroxytamoxifen. Determined by X-ray diffraction at 1.9 Å resolution. Released 8 Apr 1999.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,070
Mol. weight: 30.24 kDa
Ligands: OHT
Released: 8 Apr 1999

Explore 3ERT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3ERT contains 12 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	307-309	3
α-helix	312-322	11
α-helix	323-327	5
α-helix	342-361	20
α-helix	367-369	3
α-helix	372-394	23
β-strand	401-405	5	1
β-strand	408-411	4	1
α-helix	412-415	4
α-helix	424-438	15
α-helix	442-455	14
α-helix	466-492	27
α-helix	497-526	30
α-helix	536-544	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (estrogen receptor alpha)	A	protein	261	Homo sapiens	P03372 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3ERT_1 PROTEIN (ESTROGEN RECEPTOR ALPHA) (chains A)
MDPMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRE
LVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRN
QGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKD
HIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNV
VPLYDLLLEMLDAHRLHAPTS

Ligands and cofactors

ID	Name	Formula	Copies
OHT	4-hydroxytamoxifen	C26 H29 N O2	1

Primary citation

The structural basis of estrogen receptor/coactivator recognition and the antagonism of this interaction by tamoxifen. Shiau, A.K., Barstad, D., Loria, P.M. et al. Cell (1998) 95:927-937. DOI 10.1016/S0092-8674(00)81717-1 · PubMed

Other PDB entries of the same protein (UniProt P03372 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7BAA 1.1 Å, Cys-42-tethered stabilizer 12 of 14-3-3(sigma)/ERa PPI
8BZC 1.1 Å, co-soaked stabilizers for ERa - 14-3-3 interaction (884_AZ244)
8BZW 1.1 Å, Co-soaked stabilizers for ERa - 14-3-3 interaction (844_AZ210)
8C04 1.1 Å, Co-soaked stabilizers for ERa - 14-3-3 interaction (884_AZ354)
7B9R 1.15 Å, Cys-45-tethered stabilizer 4 of 14-3-3(sigma)/ERa PPI
7B9T 1.15 Å, Cys-45-tethered stabilizer 5 of 14-3-3(sigma)/ERa PPI
7NFW 1.19 Å, Human 14-3-3 sigma in complex with human Estrogen Receptor alpha peptide
6HMU 1.2 Å, Ternary complex of Estrogen Receptor alpha peptide and 14-3-3 sigma C45 mutant bound to…
7BA8 1.2 Å, Cys-42-tethered stabilizer 10 of 14-3-3(sigma)/ERa PPI
8APS 1.2 Å, Small molecular stabilizer for ERalpha and 14-3-3 (1083744)
8BX3 1.2 Å, fragment-linked stabilizer for ERa - 14-3-3 interaction (1074372)
8BXI 1.2 Å, fragment-linked stabilizer for ERa - 14-3-3 interaction (1074361)

Browse more

3ERT is part of these collections:

About this viewer

MolViewer shows 3ERT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.