Crystal structure of the conserved N-terminal domain of the mitotic checkpoint component BUB1. Determined by X-ray diffraction at 1.74 Å resolution. Released 17 Feb 2009.
Explore 3ESL in 3D Show helices and sheets RCSB PDB PDBe
3ESL contains 26 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 32-49 | 18 | |
| α-helix | 51-53 | 3 | |
| α-helix | 57-67 | 11 | |
| α-helix | 68-72 | 5 | |
| α-helix | 73-75 | 3 | |
| α-helix | 77-95 | 19 | |
| α-helix | 99-101 | 3 | |
| α-helix | 105-118 | 14 | |
| α-helix | 123-136 | 14 | |
| β-strand | 142 | 1 | 1 |
| α-helix | 143-155 | 13 | |
| α-helix | 159-171 | 13 | |
| β-strand | 175 | 1 | 1 |
| α-helix | 177-193 | 17 | |
| α-helix | 205-214 | 10 | |
| α-helix | 221-228 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 30-49 | 20 | |
| α-helix | 51-53 | 3 | |
| α-helix | 57-71 | 15 | |
| α-helix | 82-96 | 15 | |
| α-helix | 99-101 | 3 | |
| α-helix | 105-118 | 14 | |
| α-helix | 123-136 | 14 | |
| β-strand | 142 | 1 | 2 |
| α-helix | 143-155 | 13 | |
| α-helix | 159-171 | 13 | |
| β-strand | 175 | 1 | 2 |
| α-helix | 177-193 | 17 | |
| α-helix | 206-214 | 9 | |
| α-helix | 221-228 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Checkpoint serine/threonine-protein kinase BUB1 | A, B | protein | 202 | Saccharomyces cerevisiae | P41695 (AlphaFold model) |
>3ESL_1 Checkpoint serine/threonine-protein kinase BUB1 (chains A, B) QKEQHSQLNQTKIAYEQRLLNDLEDMDDPLDLFLDYMIWISTSYIEVDSESGQEVLRSTM ERCLIYIQDMETYRNDPRFLKIWIWYINLFLSNNFHESENTFKYMFNKGIGTKLSLFYEE FSKLLENAQFFLEAKVLLELGAENNCRPYNRLLRSLSNYEDRLREMNIVENQNSVPDSRE RLKGRLIYRTAPFFIRKFLTSS
| ID | Name | Formula | Copies |
|---|---|---|---|
| NHE | 2-[N-cyclohexylamino]ethane sulfonic acid | C8 H17 N O3 S | 2 |
The Crystal Structure of the N-Terminal Region of BUB1 Provides Insight into the Mechanism of BUB1 Recruitment to Kinetochores. Bolanos-Garcia, V.M., Kiyomitsu, T., D'Arcy, S. et al. Structure (2009) 17:105-116. DOI 10.1016/j.str.2008.10.015 · PubMed
Other PDB entries of the same protein (UniProt P41695 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 3ESL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.