2I3S: Bub3 complex with Bub1 GLEBS motif

Bub3 complex with Bub1 GLEBS motif. Determined by X-ray diffraction at 1.9 Å resolution. Released 9 Jan 2007.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Saccharomyces cerevisiae
Chains: 6
Atoms: 9,442
Mol. weight: 131.71 kDa
Released: 9 Jan 2007

Explore 2I3S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2I3S contains 29 α-helices and 99 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
α-helix	13	1
β-strand	14-20	7	2
α-helix	21-23	3
β-strand	25-30	6	2
β-strand	34-41	8	2
β-strand	46-54	9	2
β-strand	59-66	8	3
β-strand	70-76	7	3
β-strand	81-84	4	3
β-strand	92-94	3	3
α-helix	95	1
β-strand	96	1	4
β-strand	104-110	7	5
β-strand	114-119	6	5
β-strand	123-127	5	5
α-helix	129-132	4
β-strand	135	1	4
β-strand	136-141	6	5
β-strand	153-158	6	6
β-strand	162-167	6	6
β-strand	171-176	6	6
β-strand	186-189	4	6
β-strand	196-201	6	7
α-helix	204-206	3
β-strand	208-213	6	7
β-strand	217-222	6	7
β-strand	236-239	4	7
β-strand	242-243	2	8
β-strand	249-251	3	8
β-strand	254-259	6	9
α-helix	265	1
β-strand	266-270	5	9
β-strand	275-279	5	9
β-strand	284-288	5	9
α-helix	289-291	3
β-strand	296-302	7	1
β-strand	306-312	7	1
α-helix	315-318	4
α-helix	328-331	4
β-strand	332-337	6	1

Chains B, D and F: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	317-319	3	8
α-helix	323-326	4
α-helix	336-343	8

Chain C: 6 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	10
β-strand	14-20	7	11
β-strand	25-30	6	11
β-strand	34-41	8	11
β-strand	46-54	9	11
β-strand	59-66	8	12
β-strand	70-76	7	12
β-strand	81-84	4	12
β-strand	92-94	3	12
α-helix	95	1
β-strand	96	1	13
β-strand	104-110	7	14
β-strand	114-119	6	14
β-strand	123-127	5	14
β-strand	135	1	13
β-strand	140-141	2	14
β-strand	153-158	6	15
β-strand	162-167	6	15
β-strand	171-176	6	15
β-strand	186-189	4	15
β-strand	196-201	6	16
α-helix	202-203	2
α-helix	204-206	3
β-strand	208-213	6	16
β-strand	217-222	6	16
β-strand	236-239	4	16
β-strand	242-243	2	17
β-strand	249-251	3	17
β-strand	254-259	6	18
β-strand	266-270	5	18
β-strand	275-279	5	18
β-strand	284-288	5	18
α-helix	289-291	3
β-strand	296-302	7	10
β-strand	306-312	7	10
α-helix	315-318	4
α-helix	328-331	4
β-strand	332-337	6	10

Chain E: 8 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	19
α-helix	13	1
β-strand	14-20	7	20
α-helix	21-23	3
β-strand	25-30	6	20
β-strand	34-41	8	20
β-strand	46-54	9	20
β-strand	59-65	7	21
β-strand	71-76	6	21
β-strand	81-84	4	21
β-strand	92-94	3	21
α-helix	95	1
β-strand	96	1	22
β-strand	104-110	7	23
β-strand	114-119	6	23
β-strand	123-127	5	23
β-strand	135	1	22
β-strand	140-141	2	23
β-strand	153-159	7	24
β-strand	162-167	6	24
α-helix	168-170	3
β-strand	171-176	6	24
β-strand	186-189	4	24
β-strand	196-201	6	25
α-helix	204-206	3
β-strand	208-213	6	25
β-strand	217-222	6	25
β-strand	236-239	4	25
β-strand	242-243	2	26
β-strand	249-251	3	26
β-strand	256-259	4	27
β-strand	266-269	4	27
β-strand	275-279	5	27
β-strand	284-288	5	27
α-helix	289-291	3
β-strand	296-302	7	19
β-strand	306-312	7	19
α-helix	315-318	4
α-helix	329-331	3
β-strand	332-337	6	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cell cycle arrest protein	A, C, E	protein	349	Saccharomyces cerevisiae	P26449 (AlphaFold model)
Checkpoint serine/threonine-protein kinase	B, D, F	protein	36	Saccharomyces cerevisiae	P41695 (AlphaFold model)

Sequence of entity 1 (A, C, E), FASTA

>2I3S_1 Cell cycle arrest protein (chains A, C, E)
MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLL
CCNFIDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASW
DGLIEVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMDTNSSRLIVGMNNSQVQWFRLPLC
EDDNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDQGDDYNSSKRFAFRC
HRLNLKDTNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKI
ACSDNILCLATSDDTFKTNAAIDQTIELNASSIYIIFDYENELHHHHHH

Sequence of entity 2 (B, D, F), FASTA

>2I3S_2 Checkpoint serine/threonine-protein kinase (chains B, D, F)
KPERIVFNFNLIYPENDEEFNTEEILAMIKGLYKVQ

Primary citation

Structural analysis of Bub3 interactions in the mitotic spindle checkpoint. Larsen, N.A., Al-Bassam, J., Wei, R.R. et al. Proc Natl Acad Sci U S A (2007) 104:1201-1206. DOI 10.1073/pnas.0610358104 · PubMed

Other PDB entries of the same protein (UniProt P26449 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1YFQ 1.1 Å, High resolution S. cerevisiae Bub3 mitotic checkpoint protein
4BL0 1.95 Å, Crystal structure of yeast Bub3-Bub1 bound to phospho-Spc105
1U4C 2.35 Å, Structure of spindle checkpoint protein Bub3
2I3T 2.8 Å, Bub3 complex with Mad3 (BubR1) GLEBS motif

Browse structure collections

About this viewer

MolViewer shows 2I3S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.