3EWH: VEGFR2 kinase domain

Crystal structure of the VEGFR2 kinase domain in complex with a pyridyl-pyrimidine benzimidazole inhibitor. Determined by X-ray diffraction at 1.6 Å resolution. Released 25 Aug 2009.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,735
Mol. weight: 36.71 kDa
Ligands: K11
Released: 25 Aug 2009

Explore 3EWH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3EWH contains 19 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	817-819	3
α-helix	824-827	4
β-strand	828	1	1
α-helix	831-833	3
β-strand	834-843	10	1
β-strand	846-854	9	1
β-strand	862-870	9	1
α-helix	871	1
α-helix	876-892	17
β-strand	898	1	2
β-strand	901-905	5	1
β-strand	913-917	5	1
β-strand	923	1	2
α-helix	924-929	6
β-strand	935	1	3
α-helix	993-996	4
β-strand	1000	1	3
α-helix	1002-1021	20
α-helix	1031-1033	3
β-strand	1034-1036	3	2
β-strand	1042-1044	3	2
α-helix	1069-1071	3
α-helix	1074-1079	6
α-helix	1084-1099	16
α-helix	1103-1104	2
α-helix	1113-1121	9
α-helix	1125-1128	4
α-helix	1133-1142	10
α-helix	1147-1149	3
α-helix	1151-1152	2
α-helix	1153-1169	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
vascular endothelial growth factor receptor 2	A	protein	314	Homo sapiens	P35968 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3EWH_1 vascular endothelial growth factor receptor 2 (chains A)
EHAERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGA
THSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVITEFCKFGNLSTYLRSKRNE
FVPYKVAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKI
CDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGAS
PYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLL
QANAQQDRHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
K11	N-[4-({3-[2-(methylamino)pyrimidin-4-yl]pyridin-2-yl}oxy)naphthalen-1-yl]-6-(tr…	C28 H20 F3 N7 O	1

Water and common crystallization additives (EDO) are not listed.

Primary citation

Pyridyl-pyrimidine benzimidazole derivatives as potent, selective, and orally bioavailable inhibitors of Tie-2 kinase. Cee, V.J., Cheng, A.C., Romero, K. et al. Bioorg Med Chem Lett (2009) 19:424-427. DOI 10.1016/j.bmcl.2008.11.056 · PubMed

Other PDB entries of the same protein (UniProt P35968 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2XIR 1.5 Å, Crystal structure of the VEGFR2 kinase domain in complex with PF- 00337210…
3VO3 1.52 Å, Crystal Structure of the Kinase domain of Human VEGFR2 with imidazo[1,2-b]pyridazine…
6GQQ 1.52 Å, Crystal structure of human KDR (VEGFR2) kinase domain in complex with AZD3229-analogue…
3VHE 1.55 Å, Crystal structure of human VEGFR2 kinase domain with a novel pyrrolopyrimidine inhibitor.
3WZD 1.57 Å, KDR in complex with ligand lenvatinib
3VNT 1.64 Å, Crystal Structure of the Kinase domain of Human VEGFR2 with a…
1YWN 1.71 Å, Vegfr2 in complex with a novel 4-amino-furo[2,3-d]pyrimidine
3BE2 1.75 Å, Crystal structure of the VEGFR2 kinase domain in complex with a benzamide inhibitor
6XVJ 1.78 Å, Crystal structure of the KDR (VEGFR2) kinase domain in complex with a type-II inhibitor
4ASE 1.83 Å, Crystal structure of VEGFR2 (juxtamembrane and kinase domains) in complex with tivozanib…
6GQO 1.87 Å, Crystal structure of human KDR (VEGFR2) kinase domain in complex with AZD3229-analogue…
3WZE 1.9 Å, KDR in complex with ligand sorafenib

Browse structure collections

About this viewer

MolViewer shows 3EWH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.