3EZE: Protein

Complex of the amino terminal domain of enzyme I and the histidine-containing phosphocarrier protein hpr from escherichia coli NMR, restrained regularized mean structure. Determined by solution NMR. Released 16 Dec 1998.

Method: Solution NMR
Organism: Escherichia coli
Chains: 2
Atoms: 2,551
Mol. weight: 37.59 kDa
Ligands: PO3
Released: 16 Dec 1998

Explore 3EZE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3EZE contains 16 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	8	1	1
β-strand	12-18	7	1
α-helix	22-25	4
α-helix	29-31	3
α-helix	33-64	32
α-helix	67-80	14
α-helix	83-91	9
α-helix	92-96	5
α-helix	100-116	17
α-helix	121-142	22
α-helix	149-151	3
β-strand	156-160	5	1
α-helix	165-169	5
β-strand	176-181	6	1
α-helix	189-197	9
β-strand	201-202	2	1
α-helix	208-211	4
β-strand	216-220	5	1
β-strand	227-229	3	1
α-helix	233-248	16

Chain B: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	302-307	6	2
α-helix	316-327	12
β-strand	332-337	6	2
β-strand	340-343	4	2
α-helix	347-350	4
β-strand	360-366	7	2
α-helix	370-383	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (phosphotransferase system, enzyme I)	A	protein	259	Escherichia coli	P08839 (AlphaFold model)
Protein (phosphotransferase system, hpr)	B	protein	85	Escherichia coli	P0AA04 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3EZE_1 PROTEIN (PHOSPHOTRANSFERASE SYSTEM, ENZYME I) (chains A)
MISGILASPGIAFGKALLLKEDEIVIDRKKISADQVDQEVERFLSGRAKASAQLETIKTK
AGETFGEEKEAIFEGHIMLLEDEELEQEIIALIKDKHMTADAAAHEVIEGQASALEELDD
EYLKERAADVRDIGKRLLRNILGLKIIDLSAIQDEVILVAADLTPSETAQLNLKKVLGFI
TDAGGRTSHTSIMARSLELPAIVGTGSVTSQVKNDDYLILDAVNNQVYVNPTNEVIDKMR
AVQEQVASEKAELAKLKDR

Sequence of entity 2 (B), FASTA

>3EZE_2 PROTEIN (PHOSPHOTRANSFERASE SYSTEM, HPR) (chains B)
MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTV
VTISAEGEDEQKAVEHLVKLMAELE

Ligands and cofactors

ID	Name	Formula	Copies
PO3	Phosphite ion	O3 P	1

Primary citation

Solution structure of the 40,000 Mr phosphoryl transfer complex between the N-terminal domain of enzyme I and HPr. Garrett, D.S., Seok, Y.J., Peterkofsky, A. et al. Nat Struct Biol (1999) 6:166-173. DOI 10.1038/5854 · PubMed

Other PDB entries of the same protein (UniProt P08839 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6V9K 1.9 Å, Crystal structure of the hybrid C-terminal domain of enzyme I of the bacterial…
1ZYM 2.5 Å, Amino terminal domain of enzyme I from escherichia coli
2HWG 2.7 Å, Structure of phosphorylated Enzyme I of the phosphoenolpyruvate:sugar phosphotransferase…
6VU0 3.5 Å, Crystal structure of the C-terminal domain of enzyme I of the bacterial…
1EZA Amino terminal domain of enzyme I from escherichia coli NMR, restrained regularized mean…
1EZB Amino terminal domain of enzyme I from escherichia coli, NMR, 17 structures
1EZC Amino terminal domain of enzyme I from escherichia coli, NMR, 17 structures
1EZD Amino terminal domain of enzyme I from escherichia coli NMR, 16 structures
2EZA Amino terminal domain of enzyme I from escherichia coli, NMR, restrained regularized…
2EZB Amino terminal domain of enzyme I from escherichia coli, NMR, 14 structures
2EZC Amino terminal domain of enzyme I from escherichia coli, NMR, 14 structures
2KX9 Solution Structure of the Enzyme I dimer Using Residual Dipolar Couplings and Small…

Browse structure collections

About this viewer

MolViewer shows 3EZE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.