3F1I: Human ESCRT-0 Core Complex

Human ESCRT-0 Core Complex. Determined by X-ray diffraction at 2.3 Å resolution. Released 24 Mar 2009.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,642
Mol. weight: 29.32 kDa
Released: 24 Mar 2009

Explore 3F1I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3F1I contains 7 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	339-360	22

Chain H: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	405-429	25
α-helix	433-435	3
α-helix	437-499	63

Chain S: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	304-315	12
α-helix	324-326	3
α-helix	327-375	49

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hepatocyte growth factor-regulated tyrosine kinase substrate	H	protein	98	Homo sapiens	O14964 (AlphaFold model)
Signal transducing adapter molecule 1	C, S	protein	77	Homo sapiens	Q92783 (AlphaFold model)

Sequence of entity 1 (H), FASTA

>3F1I_1 Hepatocyte growth factor-regulated tyrosine kinase substrate (chains H)
SHEQFLKALQNAVTTFVNRMKSNHMRGRSITNDSAVLSLFQSINGMHPQLLELLNQLDER
RLYYEGLQDKLAQIRDARGALSALREEHREKLRRAAEE

Sequence of entity 2 (C, S), FASTA

>3F1I_2 Signal transducing adapter molecule 1 (chains C, S)
FIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSEL
NVKVMEALSLYTKLMNE

Primary citation

Hybrid Structural Model of the Complete Human ESCRT-0 Complex. Ren, X., Kloer, D.P., Kim, Y.C. et al. Structure (2009) 17:406-416. DOI 10.1016/j.str.2009.01.012 · PubMed

Other PDB entries of the same protein (UniProt O14964 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3OBQ 1.4 Å, Crystal Structure of the Tsg101 UEV domain in complex with a human HRS PSAP peptide
3ZYQ 1.48 Å, Crystal structure of the tandem VHS and FYVE domains of Hepatocyte growth…
4AVX 1.68 Å, Hepatocyte Growth Factor-Regulated Tyrosine Kinase Substrate (Hgs-Hrs) bound to an IP2…
2D3G 1.7 Å, Double sided ubiquitin binding of Hrs-UIM

Browse structure collections

About this viewer

MolViewer shows 3F1I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.