3F2O: SPRY domain-containing SOCS box protein 1

Crystal Structure of human splA/ryanodine receptor domain and SOCS box containing 1 (SPSB1) in complex with a 20-residue VASA peptide. Determined by X-ray diffraction at 2.05 Å resolution. Released 9 Dec 2008.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,777
Mol. weight: 58.06 kDa
Released: 9 Dec 2008

Explore 3F2O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3F2O contains 13 α-helices and 38 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	32-34	3
α-helix	35-42	8
α-helix	44-47	4
α-helix	48-54	7
β-strand	56-61	6	1
β-strand	65-67	3	2
β-strand	74-77	4	2
β-strand	80	1	3
β-strand	83-89	7	1
β-strand	93	1	4
β-strand	97-104	8	2
α-helix	106-108	3
β-strand	114-118	5	1
β-strand	125-127	3	1
β-strand	139-143	5	1
β-strand	148-151	4	1
β-strand	159-160	2	1
α-helix	172-174	3
β-strand	176-182	7	2
β-strand	187-192	6	2
β-strand	195-201	7	2
β-strand	209	1	4
β-strand	210-215	6	1
β-strand	221-230	10	2

Chain B: 6 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	32-34	3
α-helix	35-42	8
α-helix	44-47	4
α-helix	48-53	6
β-strand	56-61	6	5
β-strand	65-68	4	6
β-strand	71-77	7	6
β-strand	80	1	7
β-strand	83-89	7	5
β-strand	93	1	8
β-strand	97-104	8	6
α-helix	106-108	3
β-strand	114-118	5	5
β-strand	125-127	3	5
β-strand	139-143	5	5
β-strand	148-151	4	5
β-strand	159-160	2	5
α-helix	165-166	2
β-strand	176-182	7	6
β-strand	187-192	6	6
β-strand	195-201	7	6
β-strand	209	1	8
β-strand	210-215	6	5
β-strand	221-230	10	6

Chain C: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	189	1	3
α-helix	195-199	5

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	189	1	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SPRY domain-containing SOCS box protein 1	A, B	protein	233	Homo sapiens	Q96BD6 (AlphaFold model)
20-mer peptide from ATP-dependent RNA helicase vasa	C, D	protein	20		P09052 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3F2O_1 SPRY domain-containing SOCS box protein 1 (chains A, B)
MHHHHHHSSGVDLGTENLYFQSMQELQGLDYCKPTRLDLLLDMPPVSYDVQLLHSWNNND
RSLNVFVKEDDKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWAMRQRGTHAVVGVATA
DAPLHSVGYTTLVGNNHESWGWDLGRNRLYHDGKNQPSKTYPAFLEPDETFIVPDSFLVA
LDMDDGTLSFIVDGQYMGVAFRGLKGKKLYPVVSAVWGHCEIRMRYLNGLDPE

Sequence of entity 2 (C, D), FASTA

>3F2O_2 20-mer peptide from ATP-dependent RNA helicase vasa (chains C, D)
DINNNNNIVEDVERKREFYI

Primary citation

Structural basis for Par-4 recognition by the SPRY domain- and SOCS box-containing proteins SPSB1, SPSB2, and SPSB4. Filippakopoulos, P., Low, A., Sharpe, T.D. et al. J Mol Biol (2010) 401:389-402. DOI 10.1016/j.jmb.2010.06.017 · PubMed

Other PDB entries of the same protein (UniProt Q96BD6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2JK9 1.79 Å, The structure of splA-ryanodine receptor domain and SOCS box containing 1 in complex…

Browse structure collections

About this viewer

MolViewer shows 3F2O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.