3F92: Ubiquitin-conjugating enzyme E2 K

Crystal structure of ubiquitin-conjugating enzyme E2-25kDa (Huntington Interacting Protein 2) M172A mutant crystallized at pH 8.5. Determined by X-ray diffraction at 2.23 Å resolution. Released 25 Nov 2008.

Method: X-ray diffraction
Resolution: 2.23 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,722
Mol. weight: 28.83 kDa
Ligands: CA
Released: 25 Nov 2008

Explore 3F92 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3F92 contains 11 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	3-17	15
α-helix	20-23	4
β-strand	27-31	5	1
β-strand	38-44	7	1
α-helix	45-46	2
β-strand	55-61	7	1
α-helix	70-71	2
β-strand	72-75	4	1
β-strand	81	1	2
β-strand	84	1	2
β-strand	90	1	1
β-strand	91	1	2
α-helix	94-96	3
α-helix	106-118	13
α-helix	128-136	9
α-helix	138-153	16
α-helix	160-171	12
α-helix	176-185	10
α-helix	190-197	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-conjugating enzyme E2 K	A	protein	253	Homo sapiens	P61086 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3F92_1 Ubiquitin-conjugating enzyme E2 K (chains A)
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEFDMANIAVQ
RIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPETYP
FNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQD
AVVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLCAAGFDRNAVIVALSSKS
WDVETATELLLSN

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Water and common crystallization additives (TRS, BME, PG4) are not listed.

Primary citation

Structure of full-length ubiquitin-conjugating enzyme E2-25K (huntingtin-interacting protein 2). Wilson, R.C., Hughes, R.C., Flatt, J.W. et al. Acta Crystallogr Sect F Struct Biol Cryst Commun (2009) 65:440-444. DOI 10.1107/S1744309109011117 · PubMed

Other PDB entries of the same protein (UniProt P61086 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3K9O 1.8 Å, The crystal structure of E2-25K and UBB+1 complex
3E46 1.86 Å, Crystal structure of ubiquitin-conjugating enzyme E2-25kDa (Huntington interacting…
5DFL 2.1 Å, Crystal structure of Ube2K~Ubiquitin conjugate
6JB7 2.1 Å, Crystal structure of Ub-conjugated Ube2K C92K&K97A mutant (isopeptide linkage), 2.1 A…
7MYH 2.39 Å, Ubiquitin variant UbV.k.2 in complex with Ube2k
1YLA 2.4 Å, Ubiquitin-conjugating enzyme E2-25 kDa (Huntington interacting protein 2)
7OJX 2.4 Å, E2 UBE2K covalently linked to donor Ub, acceptor di-Ub, and RING E3 primed for…
6IF1 2.47 Å, Crystal structure of Ube2K and K48-linked di-ubiquitin complex
2O25 2.6 Å, Ubiquitin-Conjugating Enzyme E2-25 kDa Complexed With SUMO-1-Conjugating Enzyme UBC9
6JB6 2.7 Å, Crystal structure of Ub-conjugated Ube2K C92K&K97A mutant (isopeptide linkage), 2.7 A…
3K9P 2.8 Å, The crystal structure of E2-25K and ubiquitin complex
7MYF 3.0 Å, Ubiquitin variant UbV.k.1 in complex with Ube2k

Browse structure collections

About this viewer

MolViewer shows 3F92 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.