3FDR: TDRD2

Crystal structure of TDRD2. Determined by X-ray diffraction at 1.75 Å resolution. Released 6 Jan 2009.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Homo sapiens
Chains: 1
Atoms: 772
Mol. weight: 10.45 kDa
Released: 6 Jan 2009

Explore 3FDR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3FDR contains 7 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	6-18	13
α-helix	21-23	3
β-strand	33-38	6	1
β-strand	43-52	10	1
α-helix	57	1
β-strand	58-62	5	1
β-strand	68-71	4	1
α-helix	73-75	3
β-strand	77-78	2	1
α-helix	79-80	2
α-helix	81-84	4
α-helix	87-88	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tudor and KH domain-containing protein	A	protein	94	Homo sapiens	Q9Y2W6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3FDR_1 Tudor and KH domain-containing protein (chains A)
GSRSLQLDKLVNEMTQHYENSVPEDLTVHVGDIVAAPLPTNGSWYRARVLGTLENGNLDL
YFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECS

Primary citation

Mouse Piwi interactome identifies binding mechanism of Tdrkh Tudor domain to arginine methylated Miwi. Chen, C., Jin, J., James, D.A. et al. Proc Natl Acad Sci U S A (2009) 106:20336-20341. DOI 10.1073/pnas.0911640106 · PubMed

Other PDB entries of the same protein (UniProt Q9Y2W6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6B57 1.93 Å, tudor in complex with ligand
5J39 1.95 Å, Crystal Structure of the extended TUDOR domain from TDRD2
6PI7 2.8 Å, Crystal structure of the TDRD2 extended Tudor domain in complex with an antibody…
2DIQ Solution structure of the TUDOR domain of Tudor and KH domain containing protein

Browse structure collections

About this viewer

MolViewer shows 3FDR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.